In this tutorial, we will fold a protein structure using a very simple algorithm in PyRosetta, and compare the folded structure with the solved crystal structure of the protein.
We begin by importing the relevant libraries from Python. If running the following cell produces any errors or warnings, make sure you have followed all the steps in the "Setting up Pyrosetta" section.
import os
import glob
import shutil
import pandas as pd
import nglview as ngl
import pyrosetta as prs
prs.init()
from pyrosetta import rosetta
PyRosetta-4 2020 [Rosetta PyRosetta4.conda.linux.CentOS.python37.Release 2020.08+release.cb1cabafd7463ab703f6abf5efa33d2707b85924 2020-02-20T07:29:09] retrieved from: http://www.pyrosetta.org
(C) Copyright Rosetta Commons Member Institutions. Created in JHU by Sergey Lyskov and PyRosetta Team.
core.init: {0} Checking for fconfig files in pwd and ./rosetta/flags
core.init: {0} Rosetta version: PyRosetta4.conda.linux.CentOS.python37.Release r247 2020.08+release.cb1caba cb1cabafd7463ab703f6abf5efa33d2707b85924 http://www.pyrosetta.org 2020-02-20T07:29:09
core.init: {0} command: PyRosetta -ex1 -ex2aro -database /home/perry/miniconda3/envs/my_env/lib/python3.7/site-packages/pyrosetta/database
basic.random.init_random_generator: {0} 'RNG device' seed mode, using '/dev/urandom', seed=848455817 seed_offset=0 real_seed=848455817 thread_index=0
basic.random.init_random_generator: {0} RandomGenerator:init: Normal mode, seed=848455817 RG_type=mt19937
scorefxn_low = prs.create_score_function('score3')
scorefxn_high = prs.get_fa_scorefxn()
basic.io.database: {0} Database file opened: scoring/score_functions/EnvPairPotential/env_log.txt
basic.io.database: {0} Database file opened: scoring/score_functions/EnvPairPotential/cbeta_den.txt
basic.io.database: {0} Database file opened: scoring/score_functions/EnvPairPotential/pair_log.txt
basic.io.database: {0} Database file opened: scoring/score_functions/EnvPairPotential/cenpack_log.txt
basic.io.database: {0} Database file opened: scoring/score_functions/SecondaryStructurePotential/phi.theta.36.HS.resmooth
basic.io.database: {0} Database file opened: scoring/score_functions/SecondaryStructurePotential/phi.theta.36.SS.resmooth
core.scoring.ScoreFunctionFactory: {0} SCOREFUNCTION: ref2015
core.scoring.etable: {0} Starting energy table calculation
core.scoring.etable: {0} smooth_etable: changing atr/rep split to bottom of energy well
core.scoring.etable: {0} smooth_etable: spline smoothing lj etables (maxdis = 6)
core.scoring.etable: {0} smooth_etable: spline smoothing solvation etables (max_dis = 6)
core.scoring.etable: {0} Finished calculating energy tables.
basic.io.database: {0} Database file opened: scoring/score_functions/hbonds/ref2015_params/HBPoly1D.csv
basic.io.database: {0} Database file opened: scoring/score_functions/hbonds/ref2015_params/HBFadeIntervals.csv
basic.io.database: {0} Database file opened: scoring/score_functions/hbonds/ref2015_params/HBEval.csv
basic.io.database: {0} Database file opened: scoring/score_functions/hbonds/ref2015_params/DonStrength.csv
basic.io.database: {0} Database file opened: scoring/score_functions/hbonds/ref2015_params/AccStrength.csv
core.chemical.GlobalResidueTypeSet: {0} Finished initializing fa_standard residue type set.  Created 980 residue types
core.chemical.GlobalResidueTypeSet: {0} Total time to initialize 1.07839 seconds.
basic.io.database: {0} Database file opened: scoring/score_functions/rama/fd/all.ramaProb
basic.io.database: {0} Database file opened: scoring/score_functions/rama/fd/prepro.ramaProb
basic.io.database: {0} Database file opened: scoring/score_functions/omega/omega_ppdep.all.txt
basic.io.database: {0} Database file opened: scoring/score_functions/omega/omega_ppdep.gly.txt
basic.io.database: {0} Database file opened: scoring/score_functions/omega/omega_ppdep.pro.txt
basic.io.database: {0} Database file opened: scoring/score_functions/omega/omega_ppdep.valile.txt
basic.io.database: {0} Database file opened: scoring/score_functions/P_AA_pp/P_AA
basic.io.database: {0} Database file opened: scoring/score_functions/P_AA_pp/P_AA_n
core.scoring.P_AA: {0} shapovalov_lib::shap_p_aa_pp_smooth_level of 1( aka low_smooth ) got activated.
basic.io.database: {0} Database file opened: scoring/score_functions/P_AA_pp/shapovalov/10deg/kappa131/a20.prop
native_pose = prs.pose_from_pdb('data/1BL0/1BL0_chainA.pdb')
core.import_pose.import_pose: {0} File 'data/1BL0/1BL0_chainA.pdb' automatically determined to be of type PDB
We can check the amino acid sequence of the structure with a very simple command.
native_pose.sequence()
'DAITIHSILDWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYIRSRKMTEIAQKLKESNEPILYLAERYGFESQQTLTRTFKNYFDVPPHKYRMTNMQGESRFLHPL'
We can also assign the correct secondary structure.
DSSP = prs.rosetta.protocols.moves.DsspMover()
DSSP.apply(native_pose)    # populates the pose's Pose.secstruct
protocols.DsspMover: {0} LHHHHHHHHHHHHLLLLLLLLLHHHHHHLLLLHHHHHHHHHHHHLLLHHHHHHHHHHHHHHHHHHHLLLLHHHHHHHHLLLLHHHHHHHHHHHHLLLHHHHHLLLLLLLLLLLLLL
Let's view more information about the first residue of the protein.
print(native_pose.residue(1))
Residue 1: ASP:NtermProteinFull (ASP, D): Base: ASP Properties: POLYMER PROTEIN CANONICAL_AA LOWER_TERMINUS SC_ORBITALS POLAR CHARGED NEGATIVE_CHARGE METALBINDING ALPHA_AA L_AA Variant types: LOWER_TERMINUS_VARIANT Main-chain atoms: N CA C Backbone atoms: N CA C O 1H 2H 3H HA Side-chain atoms: CB CG OD1 OD2 1HB 2HB Atom Coordinates: N : 0.229, 36.012, 74.172 CA : 0.041, 35.606, 75.594 C : -0.096, 36.849, 76.498 O : -0.951, 36.895, 77.382 CB : 1.225, 34.718, 76.092 CG : 2.159, 34.156, 74.999 OD1: 1.688, 33.361, 74.151 OD2: 3.378, 34.497, 75.007 1H : 1.056, 35.74, 73.68 2H : -0.43, 35.723, 73.478 3H : 0.251, 36.981, 73.928 HA : -0.884, 35.037, 75.696 1HB : 1.839, 35.199, 76.854 2HB : 0.67, 33.892, 76.539 Mirrored relative to coordinates in ResidueType: FALSE
pose = prs.pose_from_sequence(native_pose.sequence())
test_pose = prs.Pose()
test_pose.assign(pose)
test_pose.pdb_info().name('Linearized Pose')
view = ngl.show_rosetta(test_pose)
view.add_ball_and_stick()
view  # zoom in to see the atoms!
We will be using the centroid representation to perform rough and fast scoring in the initial stages of the folding algorithm. Later on, we will switch to the full atom represenation to do accurate minimization and get the final structures.
to_centroid = prs.SwitchResidueTypeSetMover('centroid')
to_full_atom = prs.SwitchResidueTypeSetMover('fa_standard')
to_full_atom.apply(test_pose)
print('Full Atom Score:', scorefxn_high(test_pose))
to_centroid.apply(test_pose)
print('Centroid Score:', scorefxn_low(test_pose))
core.util.switchresiduetypeset: {0} [ WARNING ] When switching to a fa_standard ResidueTypeSet:  Pose already contains fa_standard ResidueTypes.
Full Atom Score: 46662.238534584234
Centroid Score: 454.1228630783549
# here write the code to visualize the centroid only structure and print the information of the 1st residue
view = ngl.show_rosetta(test_pose)
view.add_ball_and_stick()
view  # zoom in to see the atoms!
print(native_pose.residue(1))
print(test_pose.residue(1))
Residue 1: ASP:NtermProteinFull (ASP, D): Base: ASP Properties: POLYMER PROTEIN CANONICAL_AA LOWER_TERMINUS SC_ORBITALS POLAR CHARGED NEGATIVE_CHARGE METALBINDING ALPHA_AA L_AA Variant types: LOWER_TERMINUS_VARIANT Main-chain atoms: N CA C Backbone atoms: N CA C O 1H 2H 3H HA Side-chain atoms: CB CG OD1 OD2 1HB 2HB Atom Coordinates: N : 0.229, 36.012, 74.172 CA : 0.041, 35.606, 75.594 C : -0.096, 36.849, 76.498 O : -0.951, 36.895, 77.382 CB : 1.225, 34.718, 76.092 CG : 2.159, 34.156, 74.999 OD1: 1.688, 33.361, 74.151 OD2: 3.378, 34.497, 75.007 1H : 1.056, 35.74, 73.68 2H : -0.43, 35.723, 73.478 3H : 0.251, 36.981, 73.928 HA : -0.884, 35.037, 75.696 1HB : 1.839, 35.199, 76.854 2HB : 0.67, 33.892, 76.539 Mirrored relative to coordinates in ResidueType: FALSE Residue 1: ASP:NtermProteinFull (ASP, D): Base: ASP Properties: POLYMER PROTEIN CANONICAL_AA LOWER_TERMINUS POLAR CHARGED NEGATIVE_CHARGE ALPHA_AA L_AA Variant types: LOWER_TERMINUS_VARIANT Main-chain atoms: N CA C Backbone atoms: N CA C O H Side-chain atoms: CB CEN Atom Coordinates: N : 0, 0, 0 CA : 1.458, 0, 0 C : 2.00885, 1.42017, 0 O : 1.25096, 2.39022, -2.58987e-16 CB : 1.99452, -0.771871, -1.208 CEN: 2.35051, -1.69379, -1.45468 H : -0.5, -0.433013, -0.75 Mirrored relative to coordinates in ResidueType: FALSE
# Loading the files with the pre-computed fragmets
long_frag_filename = 'data/1BL0/9_fragments.txt'
long_frag_length = 9
short_frag_filename = 'data/1BL0/3_fragments.txt'
short_frag_length = 3
# Defining parameters of the folding algorithm
long_inserts=5  # How many 9-fragment pieces to insest during the search
short_inserts=10 # How many 3-fragment pieces to insest during the search
kT = 3.0 # Simulated Annealing temperature
cycles = 1000 # How many cycles of Monte Carlo search to run
jobs = 50 # How many trajectories in parallel to compute.
job_output = 'outputs/1BL0/decoy' # The prefix of the filenames to store the results
movemap = prs.MoveMap()
movemap.set_bb(True)
fragset_long = rosetta.core.fragment.ConstantLengthFragSet(long_frag_length, long_frag_filename)
long_frag_mover = rosetta.protocols.simple_moves.ClassicFragmentMover(fragset_long, movemap)
fragset_short = rosetta.core.fragment.ConstantLengthFragSet(short_frag_length, short_frag_filename)
short_frag_mover = rosetta.protocols.simple_moves.ClassicFragmentMover(fragset_short, movemap)
insert_long_frag = prs.RepeatMover(long_frag_mover, long_inserts)
insert_short_frag = prs.RepeatMover(short_frag_mover, short_inserts)
core.fragments.ConstantLengthFragSet: {0} finished reading top 200 9mer fragments from file data/1BL0/9_fragments.txt
core.fragments.ConstantLengthFragSet: {0} finished reading top 200 3mer fragments from file data/1BL0/3_fragments.txt
print("Number of 9mers: ", fragset_long.size())
print("Number of 3mers: ", fragset_short.size())
Number of 9mers: 21600 Number of 3mers: 1600
# Making sure the structure is in centroid-only mode for the search
test_pose.assign(pose)
to_centroid.apply(test_pose)
# Defining what sequence of actions to do between each scoring step
folding_mover = prs.SequenceMover()
folding_mover.add_mover(insert_long_frag)
folding_mover.add_mover(insert_short_frag)
mc = prs.MonteCarlo(test_pose, scorefxn_low, kT)
trial = prs.TrialMover(folding_mover, mc)
# Setting up how many cycles of search to do in each trajectory
folding = prs.RepeatMover(trial, cycles)
fast_relax_mover = prs.rosetta.protocols.relax.FastRelax(scorefxn_high)
protocols.relax.RelaxScriptManager: {0} Reading relax scripts list from database.
protocols.relax.RelaxScriptManager: {0} Looking for MonomerRelax2019.txt
protocols.relax.RelaxScriptManager: {0} ================== Reading script file: /home/perry/miniconda3/envs/my_env/lib/python3.7/site-packages/pyrosetta/database/sampling/relax_scripts/MonomerRelax2019.txt ==================
protocols.relax.RelaxScriptManager: {0} repeat %%nrepeats%%
protocols.relax.RelaxScriptManager: {0} coord_cst_weight 1.0
protocols.relax.RelaxScriptManager: {0} scale:fa_rep 0.040
protocols.relax.RelaxScriptManager: {0} repack
protocols.relax.RelaxScriptManager: {0} scale:fa_rep 0.051
protocols.relax.RelaxScriptManager: {0} min 0.01
protocols.relax.RelaxScriptManager: {0} coord_cst_weight 0.5
protocols.relax.RelaxScriptManager: {0} scale:fa_rep 0.265
protocols.relax.RelaxScriptManager: {0} repack
protocols.relax.RelaxScriptManager: {0} scale:fa_rep 0.280
protocols.relax.RelaxScriptManager: {0} min 0.01
protocols.relax.RelaxScriptManager: {0} coord_cst_weight 0.0
protocols.relax.RelaxScriptManager: {0} scale:fa_rep 0.559
protocols.relax.RelaxScriptManager: {0} repack
protocols.relax.RelaxScriptManager: {0} scale:fa_rep 0.581
protocols.relax.RelaxScriptManager: {0} min 0.01
protocols.relax.RelaxScriptManager: {0} coord_cst_weight 0.0
protocols.relax.RelaxScriptManager: {0} scale:fa_rep 1
protocols.relax.RelaxScriptManager: {0} repack
protocols.relax.RelaxScriptManager: {0} min 0.00001
protocols.relax.RelaxScriptManager: {0} accept_to_best
protocols.relax.RelaxScriptManager: {0} endrepeat
scores = [0] * (jobs + 1)
scores[0] = scorefxn_low(test_pose)
if os.path.isdir(os.path.dirname(job_output)):
    shutil.rmtree(os.path.dirname(job_output), ignore_errors=True)
os.makedirs(os.path.dirname(job_output))
jd = prs.PyJobDistributor(job_output, nstruct=jobs, scorefxn=scorefxn_high)
Working on decoy: outputs/1BL0/decoy_43.pdb
counter = 0 
while not jd.job_complete:
    # a. set necessary variables for the new trajectory
    # -reload the starting pose
    test_pose.assign(pose)
    to_centroid.apply(test_pose)
    # -change the pose's PDBInfo.name, for the PyMOL_Observer
    counter += 1
    test_pose.pdb_info().name(job_output + '_' + str(counter))
    # -reset the MonteCarlo object (sets lowest_score to that of test_pose)
    mc.reset(test_pose)
    #### if you create a custom protocol, you may have additional
    ####    variables to reset, such as kT
    #### if you create a custom protocol, this section will most likely
    ####    change, many protocols exist as single Movers or can be
    ####    chained together in a sequence (see above) so you need
    ####    only apply the final Mover
    # b. apply the refinement protocol
    folding.apply(test_pose)
    ####
    # c. export the lowest scoring decoy structure for this trajectory
    # -recover the lowest scoring decoy structure
    mc.recover_low(test_pose)
    # -store the final score for this trajectory
    # -convert the decoy to fullatom
    # the sidechain conformations will all be default,
    #    normally, the decoys would NOT be converted to fullatom before
    #    writing them to PDB (since a large number of trajectories would
    #    be considered and their fullatom score are unnecessary)
    # here the fullatom mode is reproduced to make the output easier to
    #    understand and manipulate, PyRosetta can load in PDB files of
    #    centroid structures, however you must convert to fullatom for
    #    nearly any other application
    to_full_atom.apply(test_pose)
    fast_relax_mover.apply(test_pose)
    scores[counter] = scorefxn_high(test_pose)
    # -output the fullatom decoy structure into a PDB file
    jd.output_decoy(test_pose)
    # -export the final structure to PyMOL
    test_pose.pdb_info().name(job_output + '_' + str(counter) + '_fa')
protocols.relax.FastRelax: {0} CMD: repeat  75627.8  0  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  75627.8  0  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7495.93  0  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2633 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
basic.thread_manager.RosettaThreadManager: {?} Creating a thread pool of 8 threads.
basic.thread_manager.RosettaThreadPool: {?} Launched 7 new threads.
basic.thread_manager.RosettaThread: {1} Launching thread 1.
basic.thread_manager.RosettaThread: {5} Launching thread 5.
basic.thread_manager.RosettaThread: {4} Launching thread 4.
basic.thread_manager.RosettaThread: {2} Launching thread 2.
basic.random.init_random_generator: {1} 'RNG device' seed mode, using '/dev/urandom', seed=999169264 seed_offset=0 real_seed=999169265 thread_index=1
basic.random.init_random_generator: {1} RandomGenerator:init: Normal mode, seed=999169265 RG_type=mt19937
basic.thread_manager.RosettaThread: {7} Launching thread 7.
basic.thread_manager.RosettaThread: {6} Launching thread 6.
basic.random.init_random_generator: {2} 'RNG device' seed mode, using '/dev/urandom', seed=371121314 seed_offset=0 real_seed=371121316 thread_index=2
basic.random.init_random_generator: {2} RandomGenerator:init: Normal mode, seed=371121316 RG_type=mt19937
basic.random.init_random_generator: {4} 'RNG device' seed mode, using '/dev/urandom', seed=1468254847 seed_offset=0 real_seed=1468254851 thread_index=4
basic.random.init_random_generator: {4} RandomGenerator:init: Normal mode, seed=1468254851 RG_type=mt19937
basic.random.init_random_generator: {7} 'RNG device' seed mode, using '/dev/urandom', seed=-688384811 seed_offset=0 real_seed=-688384804 thread_index=7
basic.random.init_random_generator: {7} RandomGenerator:init: Normal mode, seed=-688384804 RG_type=mt19937
basic.random.init_random_generator: {6} 'RNG device' seed mode, using '/dev/urandom', seed=1870420000 seed_offset=0 real_seed=1870420006 thread_index=6
basic.thread_manager.RosettaThread: {3} Launching thread 3.
basic.random.init_random_generator: {3} 'RNG device' seed mode, using '/dev/urandom', seed=-1163224523 seed_offset=0 real_seed=-1163224520 thread_index=3
basic.random.init_random_generator: {3} RandomGenerator:init: Normal mode, seed=-1163224520 RG_type=mt19937
basic.random.init_random_generator: {6} RandomGenerator:init: Normal mode, seed=1870420006 RG_type=mt19937
basic.random.init_random_generator: {5} 'RNG device' seed mode, using '/dev/urandom', seed=1731586511 seed_offset=0 real_seed=1731586516 thread_index=5
basic.random.init_random_generator: {5} RandomGenerator:init: Normal mode, seed=1731586516 RG_type=mt19937
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  113.697  0  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  128.378  0  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -292.028  2.72559  2.72559  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -292.028  2.72559  2.72559  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -148.644  2.72559  2.72559  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3082 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -165.678  2.72559  2.72559  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -158.231  2.72559  2.72559  0.154
protocols.relax.FastRelax: {0} CMD: min  -250.611  3.30932  3.30932  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -250.611  3.30932  3.30932  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -210.098  3.30932  3.30932  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2726 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -207.118  3.30932  3.30932  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -203.84  3.30932  3.30932  0.31955
protocols.relax.FastRelax: {0} CMD: min  -219.178  3.17012  3.17012  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -219.178  3.17012  3.17012  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -179.634  3.17012  3.17012  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2491 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -180.154  3.17012  3.17012  0.55
protocols.relax.FastRelax: {0} CMD: min  -211.853  3.40285  3.40285  0.55
protocols.relax.FastRelax: {0} MRP: 0  -211.853  -211.853  3.40285  3.40285
protocols.relax.FastRelax: {0} CMD: accept_to_best  -211.853  3.40285  3.40285  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -211.853  3.40285  3.40285  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -211.853  3.40285  3.40285  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -271.416  3.40285  3.40285  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2794 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -286.926  3.40285  3.40285  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -283.477  3.40285  3.40285  0.02805
protocols.relax.FastRelax: {0} CMD: min  -332.328  3.73312  3.73312  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -332.328  3.73312  3.73312  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -216.368  3.73312  3.73312  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3156 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -239.039  3.73312  3.73312  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -233.098  3.73312  3.73312  0.154
protocols.relax.FastRelax: {0} CMD: min  -279.644  3.62194  3.62194  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -279.644  3.62194  3.62194  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -239.101  3.62194  3.62194  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2585 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -239.662  3.62194  3.62194  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -236.522  3.62194  3.62194  0.31955
protocols.relax.FastRelax: {0} CMD: min  -245.31  3.4073  3.4073  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -245.31  3.4073  3.4073  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -203.53  3.4073  3.4073  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2417 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -203.588  3.4073  3.4073  0.55
protocols.relax.FastRelax: {0} CMD: min  -229.451  3.42916  3.42916  0.55
protocols.relax.FastRelax: {0} MRP: 1  -229.451  -229.451  3.42916  3.42916
protocols.relax.FastRelax: {0} CMD: accept_to_best  -229.451  3.42916  3.42916  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -229.451  3.42916  3.42916  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -229.451  3.42916  3.42916  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -291.572  3.42916  3.42916  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2858 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -301.047  3.42916  3.42916  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -298.979  3.42916  3.42916  0.02805
protocols.relax.FastRelax: {0} CMD: min  -341.322  3.81881  3.81881  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -341.322  3.81881  3.81881  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -232.859  3.81881  3.81881  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3120 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -246.23  3.81881  3.81881  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -240.479  3.81881  3.81881  0.154
protocols.relax.FastRelax: {0} CMD: min  -282.952  3.78049  3.78049  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -282.952  3.78049  3.78049  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -241.794  3.78049  3.78049  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2676 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -242.814  3.78049  3.78049  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -239.722  3.78049  3.78049  0.31955
protocols.relax.FastRelax: {0} CMD: min  -252.271  3.74811  3.74811  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -252.271  3.74811  3.74811  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -213.206  3.74811  3.74811  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2459 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -213.692  3.74811  3.74811  0.55
protocols.relax.FastRelax: {0} CMD: min  -231.508  4.17127  4.17127  0.55
protocols.relax.FastRelax: {0} MRP: 2  -231.508  -231.508  4.17127  4.17127
protocols.relax.FastRelax: {0} CMD: accept_to_best  -231.508  4.17127  4.17127  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -231.508  4.17127  4.17127  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -231.508  4.17127  4.17127  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -294.926  4.17127  4.17127  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2975 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -305.277  4.17127  4.17127  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -303.618  4.17127  4.17127  0.02805
protocols.relax.FastRelax: {0} CMD: min  -349.809  4.57886  4.57886  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -349.809  4.57886  4.57886  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -226.437  4.57886  4.57886  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3205 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -242.924  4.57886  4.57886  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -236.214  4.57886  4.57886  0.154
protocols.relax.FastRelax: {0} CMD: min  -292.087  4.5032  4.5032  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -292.087  4.5032  4.5032  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -252.278  4.5032  4.5032  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2872 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -254.022  4.5032  4.5032  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -250.933  4.5032  4.5032  0.31955
protocols.relax.FastRelax: {0} CMD: min  -258.639  4.36556  4.36556  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -258.639  4.36556  4.36556  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -215.011  4.36556  4.36556  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2679 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -215.471  4.36556  4.36556  0.55
protocols.relax.FastRelax: {0} CMD: min  -237.044  4.38274  4.38274  0.55
protocols.relax.FastRelax: {0} MRP: 3  -237.044  -237.044  4.38274  4.38274
protocols.relax.FastRelax: {0} CMD: accept_to_best  -237.044  4.38274  4.38274  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -237.044  4.38274  4.38274  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -237.044  4.38274  4.38274  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -299.612  4.38274  4.38274  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2952 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -308.837  4.38274  4.38274  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -307.117  4.38274  4.38274  0.02805
protocols.relax.FastRelax: {0} CMD: min  -353.674  4.81787  4.81787  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -353.674  4.81787  4.81787  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -232.533  4.81787  4.81787  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3201 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -253.14  4.81787  4.81787  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -247.071  4.81787  4.81787  0.154
protocols.relax.FastRelax: {0} CMD: min  -294.624  4.74493  4.74493  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -294.624  4.74493  4.74493  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -254.38  4.74493  4.74493  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2850 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -254.749  4.74493  4.74493  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -251.629  4.74493  4.74493  0.31955
protocols.relax.FastRelax: {0} CMD: min  -259.617  4.64115  4.64115  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -259.617  4.64115  4.64115  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -216.817  4.64115  4.64115  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2814 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -217.087  4.64115  4.64115  0.55
protocols.relax.FastRelax: {0} CMD: min  -237.576  4.6623  4.6623  0.55
protocols.relax.FastRelax: {0} MRP: 4  -237.576  -237.576  4.6623  4.6623
protocols.relax.FastRelax: {0} CMD: accept_to_best  -237.576  4.6623  4.6623  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -237.576  4.6623  4.6623  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_38.pdb
protocols.relax.FastRelax: {0} CMD: repeat  66731.5  17.5434  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  66731.5  17.5434  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  6522.97  17.5434  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2574 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  155.839  17.5434  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  171.057  17.5434  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -239.709  17.339  3.41534  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -239.709  17.339  3.41534  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -115.047  17.339  3.41534  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2814 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -144.594  17.339  3.41534  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -138.517  17.339  3.41534  0.154
protocols.relax.FastRelax: {0} CMD: min  -197.665  17.5609  3.43663  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -197.665  17.5609  3.43663  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -156.531  17.5609  3.43663  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2569 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -157.795  17.5609  3.43663  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -154.712  17.5609  3.43663  0.31955
protocols.relax.FastRelax: {0} CMD: min  -176.947  17.536  3.52697  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -176.947  17.536  3.52697  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -140.208  17.536  3.52697  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2496 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -140.907  17.536  3.52697  0.55
protocols.relax.FastRelax: {0} CMD: min  -165.452  17.7325  4.22911  0.55
protocols.relax.FastRelax: {0} MRP: 0  -165.452  -165.452  17.7325  4.22911
protocols.relax.FastRelax: {0} CMD: accept_to_best  -165.452  17.7325  4.22911  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -165.452  17.7325  4.22911  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -165.452  17.7325  4.22911  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -226.189  17.7325  4.22911  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2738 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -240.643  17.7325  4.22911  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -237.016  17.7325  4.22911  0.02805
protocols.relax.FastRelax: {0} CMD: min  -298.421  17.5675  4.31048  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -298.421  17.5675  4.31048  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -165.413  17.5675  4.31048  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2852 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -179.414  17.5675  4.31048  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -172.332  17.5675  4.31048  0.154
protocols.relax.FastRelax: {0} CMD: min  -231.038  17.8447  4.06149  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -231.038  17.8447  4.06149  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -187.617  17.8447  4.06149  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2690 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -187.936  17.8447  4.06149  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -184.527  17.8447  4.06149  0.31955
protocols.relax.FastRelax: {0} CMD: min  -195.068  17.9945  4.02202  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -195.068  17.9945  4.02202  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -150.177  17.9945  4.02202  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2613 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -150.214  17.9945  4.02202  0.55
protocols.relax.FastRelax: {0} CMD: min  -185.993  18.2387  3.69483  0.55
protocols.relax.FastRelax: {0} MRP: 1  -185.993  -185.993  18.2387  3.69483
protocols.relax.FastRelax: {0} CMD: accept_to_best  -185.993  18.2387  3.69483  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -185.993  18.2387  3.69483  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -185.993  18.2387  3.69483  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -248.561  18.2387  3.69483  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2569 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -267.615  18.2387  3.69483  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -263.515  18.2387  3.69483  0.02805
protocols.relax.FastRelax: {0} CMD: min  -308.802  17.7906  3.57298  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -308.802  17.7906  3.57298  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -160.361  17.7906  3.57298  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2752 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -196.049  17.7906  3.57298  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -189.766  17.7906  3.57298  0.154
protocols.relax.FastRelax: {0} CMD: min  -251.737  18.0288  3.4003  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -251.737  18.0288  3.4003  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -214.899  18.0288  3.4003  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2605 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -215.721  18.0288  3.4003  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -212.783  18.0288  3.4003  0.31955
protocols.relax.FastRelax: {0} CMD: min  -221.92  18.1066  3.32667  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -221.92  18.1066  3.32667  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -182.963  18.1066  3.32667  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2414 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -183.13  18.1066  3.32667  0.55
protocols.relax.FastRelax: {0} CMD: min  -197.176  18.1534  3.11403  0.55
protocols.relax.FastRelax: {0} MRP: 2  -197.176  -197.176  18.1534  3.11403
protocols.relax.FastRelax: {0} CMD: accept_to_best  -197.176  18.1534  3.11403  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -197.176  18.1534  3.11403  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -197.176  18.1534  3.11403  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -259.973  18.1534  3.11403  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2602 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -270.619  18.1534  3.11403  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -267.692  18.1534  3.11403  0.02805
protocols.relax.FastRelax: {0} CMD: min  -309.167  17.7612  3.33679  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -309.167  17.7612  3.33679  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -191.09  17.7612  3.33679  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2873 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -206.657  17.7612  3.33679  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -200.702  17.7612  3.33679  0.154
protocols.relax.FastRelax: {0} CMD: min  -252.474  17.9701  3.27335  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -252.474  17.9701  3.27335  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -215.06  17.9701  3.27335  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2699 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -216.943  17.9701  3.27335  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -214.072  17.9701  3.27335  0.31955
protocols.relax.FastRelax: {0} CMD: min  -222.772  18.1004  3.21272  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -222.772  18.1004  3.21272  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -183.889  18.1004  3.21272  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2443 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -183.946  18.1004  3.21272  0.55
protocols.relax.FastRelax: {0} CMD: min  -199.599  18.1506  3.08086  0.55
protocols.relax.FastRelax: {0} MRP: 3  -199.599  -199.599  18.1506  3.08086
protocols.relax.FastRelax: {0} CMD: accept_to_best  -199.599  18.1506  3.08086  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -199.599  18.1506  3.08086  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -199.599  18.1506  3.08086  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -262.298  18.1506  3.08086  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2669 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -273.637  18.1506  3.08086  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -269.698  18.1506  3.08086  0.02805
protocols.relax.FastRelax: {0} CMD: min  -310.937  17.603  3.21084  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -310.937  17.603  3.21084  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -184.081  17.603  3.21084  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2899 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -210.98  17.603  3.21084  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -205.156  17.603  3.21084  0.154
protocols.relax.FastRelax: {0} CMD: min  -259.675  17.9691  3.33207  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -259.675  17.9691  3.33207  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -220.791  17.9691  3.33207  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2823 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -222.245  17.9691  3.33207  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -219.271  17.9691  3.33207  0.31955
protocols.relax.FastRelax: {0} CMD: min  -226.815  18.0821  3.22351  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -226.815  18.0821  3.22351  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -186.929  18.0821  3.22351  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2525 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -187.371  18.0821  3.22351  0.55
protocols.relax.FastRelax: {0} CMD: min  -204.065  18.1777  3.27673  0.55
protocols.relax.FastRelax: {0} MRP: 4  -204.065  -204.065  18.1777  3.27673
protocols.relax.FastRelax: {0} CMD: accept_to_best  -204.065  18.1777  3.27673  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -204.065  18.1777  3.27673  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_4.pdb
protocols.relax.FastRelax: {0} CMD: repeat  66106.2  14.1483  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  66106.2  14.1483  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  6286.71  14.1483  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2642 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -55.3121  14.1483  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -35.1799  14.1483  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -201.631  14.0842  6.0424  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -201.631  14.0842  6.0424  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -38.0947  14.0842  6.0424  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2327 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -77.937  14.0842  6.0424  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -69.853  14.0842  6.0424  0.154
protocols.relax.FastRelax: {0} CMD: min  -154.099  14.1031  6.26954  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -154.099  14.1031  6.26954  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -103.898  14.1031  6.26954  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2303 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -106.633  14.1031  6.26954  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -102.789  14.1031  6.26954  0.31955
protocols.relax.FastRelax: {0} CMD: min  -120.718  14.0011  5.71148  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -120.718  14.0011  5.71148  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -71.7365  14.0011  5.71148  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2141 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -72.3394  14.0011  5.71148  0.55
protocols.relax.FastRelax: {0} CMD: min  -140.73  13.5361  5.98884  0.55
protocols.relax.FastRelax: {0} MRP: 0  -140.73  -140.73  13.5361  5.98884
protocols.relax.FastRelax: {0} CMD: accept_to_best  -140.73  13.5361  5.98884  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -140.73  13.5361  5.98884  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -140.73  13.5361  5.98884  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -209.476  13.5361  5.98884  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2324 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -224.572  13.5361  5.98884  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -221.227  13.5361  5.98884  0.02805
protocols.relax.FastRelax: {0} CMD: min  -261.731  13.1724  5.23153  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -261.731  13.1724  5.23153  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -132.619  13.1724  5.23153  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2455 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -161.219  13.1724  5.23153  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -154.999  13.1724  5.23153  0.154
protocols.relax.FastRelax: {0} CMD: min  -204.19  13.1902  5.50077  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -204.19  13.1902  5.50077  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -161.603  13.1902  5.50077  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2271 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -161.618  13.1902  5.50077  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -158.261  13.1902  5.50077  0.31955
protocols.relax.FastRelax: {0} CMD: min  -167.277  13.328  5.83372  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -167.277  13.328  5.83372  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -122.074  13.328  5.83372  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2121 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -122.217  13.328  5.83372  0.55
protocols.relax.FastRelax: {0} CMD: min  -154.191  13.763  7.57032  0.55
protocols.relax.FastRelax: {0} MRP: 1  -154.191  -154.191  13.763  7.57032
protocols.relax.FastRelax: {0} CMD: accept_to_best  -154.191  13.763  7.57032  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -154.191  13.763  7.57032  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -154.191  13.763  7.57032  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -220.216  13.763  7.57032  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2302 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -231.1  13.763  7.57032  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -228.801  13.763  7.57032  0.02805
protocols.relax.FastRelax: {0} CMD: min  -280.083  12.9106  6.44881  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -280.083  12.9106  6.44881  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -161.353  12.9106  6.44881  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2586 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -179.108  12.9106  6.44881  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -172.621  12.9106  6.44881  0.154
protocols.relax.FastRelax: {0} CMD: min  -223.145  12.97  6.91466  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -223.145  12.97  6.91466  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -178.192  12.97  6.91466  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2382 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -178.291  12.97  6.91466  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -174.766  12.97  6.91466  0.31955
protocols.relax.FastRelax: {0} CMD: min  -181.917  13.2476  6.94562  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -181.917  13.2476  6.94562  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -133.57  13.2476  6.94562  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2231 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -136.101  13.2476  6.94562  0.55
protocols.relax.FastRelax: {0} CMD: min  -162.297  13.3867  7.95326  0.55
protocols.relax.FastRelax: {0} MRP: 2  -162.297  -162.297  13.3867  7.95326
protocols.relax.FastRelax: {0} CMD: accept_to_best  -162.297  13.3867  7.95326  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -162.297  13.3867  7.95326  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -162.297  13.3867  7.95326  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -231.471  13.3867  7.95326  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2391 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -241.565  13.3867  7.95326  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -239.656  13.3867  7.95326  0.02805
protocols.relax.FastRelax: {0} CMD: min  -267.31  12.7894  7.6788  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -267.31  12.7894  7.6788  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -168.684  12.7894  7.6788  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2519 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -198.3  12.7894  7.6788  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -194.638  12.7894  7.6788  0.154
protocols.relax.FastRelax: {0} CMD: min  -215.074  12.6607  7.63703  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -215.074  12.6607  7.63703  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -172.799  12.6607  7.63703  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2460 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -176.059  12.6607  7.63703  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -172.72  12.6607  7.63703  0.31955
protocols.relax.FastRelax: {0} CMD: min  -183.871  12.8304  7.63194  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -183.871  12.8304  7.63194  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -141.085  12.8304  7.63194  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2281 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -141.226  12.8304  7.63194  0.55
protocols.relax.FastRelax: {0} CMD: min  -161.037  13.0325  7.31106  0.55
protocols.relax.FastRelax: {0} MRP: 3  -161.037  -162.297  13.3867  7.95326
protocols.relax.FastRelax: {0} CMD: accept_to_best  -161.037  13.0325  7.31106  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -161.037  13.0325  7.31106  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -161.037  13.0325  7.31106  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -229.105  13.0325  7.31106  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2454 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -237.104  13.0325  7.31106  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -235.251  13.0325  7.31106  0.02805
protocols.relax.FastRelax: {0} CMD: min  -276.167  12.2745  6.12981  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -276.167  12.2745  6.12981  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -153.307  12.2745  6.12981  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2794 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -176.489  12.2745  6.12981  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -169.871  12.2745  6.12981  0.154
protocols.relax.FastRelax: {0} CMD: min  -226.193  12.3836  6.63093  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -226.193  12.3836  6.63093  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -182.763  12.3836  6.63093  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2489 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -183.577  12.3836  6.63093  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -180.126  12.3836  6.63093  0.31955
protocols.relax.FastRelax: {0} CMD: min  -193.517  12.4764  6.73146  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -193.517  12.4764  6.73146  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -151.254  12.4764  6.73146  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2301 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -151.34  12.4764  6.73146  0.55
protocols.relax.FastRelax: {0} CMD: min  -171.492  12.3317  5.85048  0.55
protocols.relax.FastRelax: {0} MRP: 4  -171.492  -171.492  12.3317  5.85048
protocols.relax.FastRelax: {0} CMD: accept_to_best  -171.492  12.3317  5.85048  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -171.492  12.3317  5.85048  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_11.pdb
protocols.relax.FastRelax: {0} CMD: repeat  73219.6  13.8372  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  73219.6  13.8372  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7449.43  13.8372  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3026 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  126.881  13.8372  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  146.475  13.8372  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -246.46  14.044  1.85865  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -246.46  14.044  1.85865  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -110.227  14.044  1.85865  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2971 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -127.845  14.044  1.85865  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -120.335  14.044  1.85865  0.154
protocols.relax.FastRelax: {0} CMD: min  -206.315  14.0839  2.04816  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -206.315  14.0839  2.04816  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -160.399  14.0839  2.04816  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2866 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -161.832  14.0839  2.04816  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -158.367  14.0839  2.04816  0.31955
protocols.relax.FastRelax: {0} CMD: min  -169.148  14.1114  2.04218  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -169.148  14.1114  2.04218  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -121.593  14.1114  2.04218  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2746 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -122.437  14.1114  2.04218  0.55
protocols.relax.FastRelax: {0} CMD: min  -177.837  14.1206  2.10595  0.55
protocols.relax.FastRelax: {0} MRP: 0  -177.837  -177.837  14.1206  2.10595
protocols.relax.FastRelax: {0} CMD: accept_to_best  -177.837  14.1206  2.10595  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -177.837  14.1206  2.10595  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -177.837  14.1206  2.10595  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -242.062  14.1206  2.10595  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2990 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -255.776  14.1206  2.10595  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -253.904  14.1206  2.10595  0.02805
protocols.relax.FastRelax: {0} CMD: min  -297.971  14.0285  2.24232  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -297.971  14.0285  2.24232  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -197.131  14.0285  2.24232  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3170 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -215.558  14.0285  2.24232  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -210.32  14.0285  2.24232  0.154
protocols.relax.FastRelax: {0} CMD: min  -248.309  14.0514  2.06453  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -248.309  14.0514  2.06453  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -209.026  14.0514  2.06453  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3089 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -209.313  14.0514  2.06453  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -206.312  14.0514  2.06453  0.31955
protocols.relax.FastRelax: {0} CMD: min  -212.11  14.0486  2.02665  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -212.11  14.0486  2.02665  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -167.643  14.0486  2.02665  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2821 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -167.966  14.0486  2.02665  0.55
protocols.relax.FastRelax: {0} CMD: min  -195.655  14.1492  2.18371  0.55
protocols.relax.FastRelax: {0} MRP: 1  -195.655  -195.655  14.1492  2.18371
protocols.relax.FastRelax: {0} CMD: accept_to_best  -195.655  14.1492  2.18371  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -195.655  14.1492  2.18371  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -195.655  14.1492  2.18371  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -259.483  14.1492  2.18371  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3186 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -265.358  14.1492  2.18371  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -262.845  14.1492  2.18371  0.02805
protocols.relax.FastRelax: {0} CMD: min  -308.858  14.0846  2.30848  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -308.858  14.0846  2.30848  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -204.03  14.0846  2.30848  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3170 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -224.377  14.0846  2.30848  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -219.164  14.0846  2.30848  0.154
protocols.relax.FastRelax: {0} CMD: min  -258.101  14.1349  2.20236  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -258.101  14.1349  2.20236  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -217.184  14.1349  2.20236  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2918 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -217.264  14.1349  2.20236  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -214.05  14.1349  2.20236  0.31955
protocols.relax.FastRelax: {0} CMD: min  -222.466  14.13  2.13112  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -222.466  14.13  2.13112  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -178.445  14.13  2.13112  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2769 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -179.125  14.13  2.13112  0.55
protocols.relax.FastRelax: {0} CMD: min  -198.477  14.1442  2.17258  0.55
protocols.relax.FastRelax: {0} MRP: 2  -198.477  -198.477  14.1442  2.17258
protocols.relax.FastRelax: {0} CMD: accept_to_best  -198.477  14.1442  2.17258  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -198.477  14.1442  2.17258  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -198.477  14.1442  2.17258  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -261.637  14.1442  2.17258  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3048 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -267.733  14.1442  2.17258  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -266.02  14.1442  2.17258  0.02805
protocols.relax.FastRelax: {0} CMD: min  -308.451  14.0849  2.36245  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -308.451  14.0849  2.36245  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -210.488  14.0849  2.36245  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3102 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -227.934  14.0849  2.36245  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -222.988  14.0849  2.36245  0.154
protocols.relax.FastRelax: {0} CMD: min  -257.186  14.101  2.24719  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -257.186  14.101  2.24719  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -218.216  14.101  2.24719  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3035 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -218.51  14.101  2.24719  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -215.453  14.101  2.24719  0.31955
protocols.relax.FastRelax: {0} CMD: min  -225.232  14.125  2.21236  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -225.232  14.125  2.21236  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -185.817  14.125  2.21236  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2848 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -185.881  14.125  2.21236  0.55
protocols.relax.FastRelax: {0} CMD: min  -197.907  14.1425  2.16923  0.55
protocols.relax.FastRelax: {0} MRP: 3  -197.907  -198.477  14.1442  2.17258
protocols.relax.FastRelax: {0} CMD: accept_to_best  -197.907  14.1425  2.16923  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -197.907  14.1425  2.16923  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -197.907  14.1425  2.16923  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -261.169  14.1425  2.16923  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3139 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -266.355  14.1425  2.16923  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -263.707  14.1425  2.16923  0.02805
protocols.relax.FastRelax: {0} CMD: min  -310.198  14.0657  2.40167  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -310.198  14.0657  2.40167  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -189.161  14.0657  2.40167  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3166 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -216.772  14.0657  2.40167  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -211.189  14.0657  2.40167  0.154
protocols.relax.FastRelax: {0} CMD: min  -256.142  14.1197  2.22589  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -256.142  14.1197  2.22589  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -217.225  14.1197  2.22589  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2868 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -217.707  14.1197  2.22589  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -214.615  14.1197  2.22589  0.31955
protocols.relax.FastRelax: {0} CMD: min  -224.239  14.1332  2.20185  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -224.239  14.1332  2.20185  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -184.342  14.1332  2.20185  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2642 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -184.385  14.1332  2.20185  0.55
protocols.relax.FastRelax: {0} CMD: min  -199.234  14.1476  2.16701  0.55
protocols.relax.FastRelax: {0} MRP: 4  -199.234  -199.234  14.1476  2.16701
protocols.relax.FastRelax: {0} CMD: accept_to_best  -199.234  14.1476  2.16701  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -199.234  14.1476  2.16701  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_48.pdb
protocols.relax.FastRelax: {0} CMD: repeat  71584.2  15.7623  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  71584.2  15.7623  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7103.74  15.7623  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3334 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  101.421  15.7623  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  123.966  15.7623  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -233.809  15.6864  2.13331  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -233.809  15.6864  2.13331  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -101.962  15.6864  2.13331  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3184 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -138.129  15.6864  2.13331  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -132.284  15.6864  2.13331  0.154
protocols.relax.FastRelax: {0} CMD: min  -214.534  15.4484  2.51194  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -214.534  15.4484  2.51194  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -176.082  15.4484  2.51194  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3228 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -181.527  15.4484  2.51194  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -178.552  15.4484  2.51194  0.31955
protocols.relax.FastRelax: {0} CMD: min  -188.789  15.4549  2.57673  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -188.789  15.4549  2.57673  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -148.658  15.4549  2.57673  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3159 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -149.878  15.4549  2.57673  0.55
protocols.relax.FastRelax: {0} CMD: min  -203.092  15.5613  3.06312  0.55
protocols.relax.FastRelax: {0} MRP: 0  -203.092  -203.092  15.5613  3.06312
protocols.relax.FastRelax: {0} CMD: accept_to_best  -203.092  15.5613  3.06312  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -203.092  15.5613  3.06312  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -203.092  15.5613  3.06312  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -258.25  15.5613  3.06312  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3429 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -267.099  15.5613  3.06312  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -264.693  15.5613  3.06312  0.02805
protocols.relax.FastRelax: {0} CMD: min  -319.787  15.308  2.87554  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -319.787  15.308  2.87554  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -200.206  15.308  2.87554  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3482 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -214.632  15.308  2.87554  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -207.775  15.308  2.87554  0.154
protocols.relax.FastRelax: {0} CMD: min  -259.88  15.464  2.97787  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -259.88  15.464  2.97787  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -215.11  15.464  2.97787  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3211 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -216.804  15.464  2.97787  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -213.378  15.464  2.97787  0.31955
protocols.relax.FastRelax: {0} CMD: min  -232.972  15.5453  3.04963  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -232.972  15.5453  3.04963  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -194.511  15.5453  3.04963  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2937 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -195.827  15.5453  3.04963  0.55
protocols.relax.FastRelax: {0} CMD: min  -215.805  15.7846  3.16827  0.55
protocols.relax.FastRelax: {0} MRP: 1  -215.805  -215.805  15.7846  3.16827
protocols.relax.FastRelax: {0} CMD: accept_to_best  -215.805  15.7846  3.16827  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -215.805  15.7846  3.16827  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -215.805  15.7846  3.16827  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -275.54  15.7846  3.16827  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3441 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -281.815  15.7846  3.16827  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -280.508  15.7846  3.16827  0.02805
protocols.relax.FastRelax: {0} CMD: min  -315.555  15.4926  3.16493  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -315.555  15.4926  3.16493  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -219.527  15.4926  3.16493  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3839 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -235.581  15.4926  3.16493  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -230.487  15.4926  3.16493  0.154
protocols.relax.FastRelax: {0} CMD: min  -268.761  15.6222  3.15019  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -268.761  15.6222  3.15019  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -230.687  15.6222  3.15019  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3446 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -231.285  15.6222  3.15019  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -228.33  15.6222  3.15019  0.31955
protocols.relax.FastRelax: {0} CMD: min  -239.367  15.7233  3.26153  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -239.367  15.7233  3.26153  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -203.122  15.7233  3.26153  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3254 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -203.127  15.7233  3.26153  0.55
protocols.relax.FastRelax: {0} CMD: min  -218.662  15.8292  3.23358  0.55
protocols.relax.FastRelax: {0} MRP: 2  -218.662  -218.662  15.8292  3.23358
protocols.relax.FastRelax: {0} CMD: accept_to_best  -218.662  15.8292  3.23358  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -218.662  15.8292  3.23358  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -218.662  15.8292  3.23358  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -278.206  15.8292  3.23358  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3525 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -282.183  15.8292  3.23358  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -280.648  15.8292  3.23358  0.02805
protocols.relax.FastRelax: {0} CMD: min  -319.944  15.5123  3.09844  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -319.944  15.5123  3.09844  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -223.542  15.5123  3.09844  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3793 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -241.593  15.5123  3.09844  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -236.609  15.5123  3.09844  0.154
protocols.relax.FastRelax: {0} CMD: min  -270.826  15.6081  3.12072  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -270.826  15.6081  3.12072  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -232.147  15.6081  3.12072  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3532 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -232.623  15.6081  3.12072  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -229.571  15.6081  3.12072  0.31955
protocols.relax.FastRelax: {0} CMD: min  -241.296  15.6974  3.1561  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -241.296  15.6974  3.1561  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -204.1  15.6974  3.1561  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3221 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -204.21  15.6974  3.1561  0.55
protocols.relax.FastRelax: {0} CMD: min  -218.337  15.7334  3.16177  0.55
protocols.relax.FastRelax: {0} MRP: 3  -218.337  -218.662  15.8292  3.23358
protocols.relax.FastRelax: {0} CMD: accept_to_best  -218.337  15.7334  3.16177  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -218.337  15.7334  3.16177  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -218.337  15.7334  3.16177  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -279.822  15.7334  3.16177  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3471 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -284.782  15.7334  3.16177  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -283.153  15.7334  3.16177  0.02805
protocols.relax.FastRelax: {0} CMD: min  -321.793  15.4937  3.16863  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -321.793  15.4937  3.16863  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -196.843  15.4937  3.16863  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3717 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -223.835  15.4937  3.16863  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -217.427  15.4937  3.16863  0.154
protocols.relax.FastRelax: {0} CMD: min  -271.911  15.5891  3.20258  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -271.911  15.5891  3.20258  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -232.978  15.5891  3.20258  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3501 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -234.395  15.5891  3.20258  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -231.344  15.5891  3.20258  0.31955
protocols.relax.FastRelax: {0} CMD: min  -241.822  15.6907  3.26852  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -241.822  15.6907  3.26852  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -203.679  15.6907  3.26852  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3152 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -203.997  15.6907  3.26852  0.55
protocols.relax.FastRelax: {0} CMD: min  -220.541  15.7037  3.25982  0.55
protocols.relax.FastRelax: {0} MRP: 4  -220.541  -220.541  15.7037  3.25982
protocols.relax.FastRelax: {0} CMD: accept_to_best  -220.541  15.7037  3.25982  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -220.541  15.7037  3.25982  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_5.pdb
protocols.relax.FastRelax: {0} CMD: repeat  66045  15.4036  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  66045  15.4036  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7137.72  15.4036  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2276 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -89.4071  15.4036  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -60.1575  15.4036  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -123.341  16.3208  4.49939  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -123.341  16.3208  4.49939  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  623.099  16.3208  4.49939  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2500 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  412.22  16.3208  4.49939  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  452.205  16.3208  4.49939  0.154
protocols.relax.FastRelax: {0} CMD: min  -200.12  15.2905  1.95821  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -200.12  15.2905  1.95821  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -155.653  15.2905  1.95821  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2283 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -160.991  15.2905  1.95821  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -157.567  15.2905  1.95821  0.31955
protocols.relax.FastRelax: {0} CMD: min  -197.139  15.7732  2.71018  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -197.139  15.7732  2.71018  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -159.643  15.7732  2.71018  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2123 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -160.624  15.7732  2.71018  0.55
protocols.relax.FastRelax: {0} CMD: min  -202.298  15.5179  3.06908  0.55
protocols.relax.FastRelax: {0} MRP: 0  -202.298  -202.298  15.5179  3.06908
protocols.relax.FastRelax: {0} CMD: accept_to_best  -202.298  15.5179  3.06908  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -202.298  15.5179  3.06908  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -202.298  15.5179  3.06908  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -262.01  15.5179  3.06908  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2333 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -273.124  15.5179  3.06908  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -271.548  15.5179  3.06908  0.02805
protocols.relax.FastRelax: {0} CMD: min  -277.688  15.3369  3.33276  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -277.688  15.3369  3.33276  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -243.583  15.3369  3.33276  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2235 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -248.032  15.3369  3.33276  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -246.465  15.3369  3.33276  0.154
protocols.relax.FastRelax: {0} CMD: min  -248.508  15.4815  3.16351  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -248.508  15.4815  3.16351  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -220.975  15.4815  3.16351  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2247 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -221.935  15.4815  3.16351  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -219.8  15.4815  3.16351  0.31955
protocols.relax.FastRelax: {0} CMD: min  -227.739  15.5633  3.04291  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -227.739  15.5633  3.04291  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -192.725  15.5633  3.04291  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2273 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -192.935  15.5633  3.04291  0.55
protocols.relax.FastRelax: {0} CMD: min  -204.757  15.3995  3.07809  0.55
protocols.relax.FastRelax: {0} MRP: 1  -204.757  -204.757  15.3995  3.07809
protocols.relax.FastRelax: {0} CMD: accept_to_best  -204.757  15.3995  3.07809  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -204.757  15.3995  3.07809  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -204.757  15.3995  3.07809  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -264.811  15.3995  3.07809  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2408 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -276.058  15.3995  3.07809  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -274.157  15.3995  3.07809  0.02805
protocols.relax.FastRelax: {0} CMD: min  -300.024  15.0201  3.21679  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -300.024  15.0201  3.21679  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -176.526  15.0201  3.21679  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2575 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -208.374  15.0201  3.21679  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -202.518  15.0201  3.21679  0.154
protocols.relax.FastRelax: {0} CMD: min  -251.981  15.2818  3.29512  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -251.981  15.2818  3.29512  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -214.965  15.2818  3.29512  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2432 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -215.615  15.2818  3.29512  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -212.747  15.2818  3.29512  0.31955
protocols.relax.FastRelax: {0} CMD: min  -214.896  15.3647  3.1191  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -214.896  15.3647  3.1191  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -164.138  15.3647  3.1191  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2393 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -166.197  15.3647  3.1191  0.55
protocols.relax.FastRelax: {0} CMD: min  -203.104  15.7153  3.03921  0.55
protocols.relax.FastRelax: {0} MRP: 2  -203.104  -204.757  15.3995  3.07809
protocols.relax.FastRelax: {0} CMD: accept_to_best  -203.104  15.7153  3.03921  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -203.104  15.7153  3.03921  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -203.104  15.7153  3.03921  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -263.729  15.7153  3.03921  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2639 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -277.349  15.7153  3.03921  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -275.096  15.7153  3.03921  0.02805
protocols.relax.FastRelax: {0} CMD: min  -279.435  15.6185  3.18182  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -279.435  15.6185  3.18182  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -235.063  15.6185  3.18182  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2499 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -250.23  15.6185  3.18182  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -248.784  15.6185  3.18182  0.154
protocols.relax.FastRelax: {0} CMD: min  -249.623  15.6181  3.07301  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -249.623  15.6181  3.07301  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -223.501  15.6181  3.07301  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2429 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -224.954  15.6181  3.07301  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -223.023  15.6181  3.07301  0.31955
protocols.relax.FastRelax: {0} CMD: min  -225.677  15.7144  3.09197  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -225.677  15.7144  3.09197  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -192.071  15.7144  3.09197  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2389 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -192.075  15.7144  3.09197  0.55
protocols.relax.FastRelax: {0} CMD: min  -204.973  15.778  3.0717  0.55
protocols.relax.FastRelax: {0} MRP: 3  -204.973  -204.973  15.778  3.0717
protocols.relax.FastRelax: {0} CMD: accept_to_best  -204.973  15.778  3.0717  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -204.973  15.778  3.0717  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -204.973  15.778  3.0717  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -265.182  15.778  3.0717  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2583 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -276.077  15.778  3.0717  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -273.402  15.778  3.0717  0.02805
protocols.relax.FastRelax: {0} CMD: min  -302.81  15.777  3.15793  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -302.81  15.777  3.15793  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -158.323  15.777  3.15793  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2688 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -200.78  15.777  3.15793  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -194.396  15.777  3.15793  0.154
protocols.relax.FastRelax: {0} CMD: min  -256.969  16.2119  3.59192  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -256.969  16.2119  3.59192  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -222.008  16.2119  3.59192  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2400 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -223.351  16.2119  3.59192  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -220.671  16.2119  3.59192  0.31955
protocols.relax.FastRelax: {0} CMD: min  -229.334  16.2442  3.70698  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -229.334  16.2442  3.70698  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -193.015  16.2442  3.70698  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2373 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -193.371  16.2442  3.70698  0.55
protocols.relax.FastRelax: {0} CMD: min  -212.465  16.2693  4.24655  0.55
protocols.relax.FastRelax: {0} MRP: 4  -212.465  -212.465  16.2693  4.24655
protocols.relax.FastRelax: {0} CMD: accept_to_best  -212.465  16.2693  4.24655  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -212.465  16.2693  4.24655  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_33.pdb
protocols.relax.FastRelax: {0} CMD: repeat  75487.8  12.7277  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  75487.8  12.7277  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7753.04  12.7277  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2135 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  125.171  12.7277  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  140.579  12.7277  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  347.45  13.8134  9.44927  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  347.45  13.8134  9.44927  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  2961.02  13.8134  9.44927  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2740 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  2007.97  13.8134  9.44927  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  2134.31  13.8134  9.44927  0.154
protocols.relax.FastRelax: {0} CMD: min  -196.199  10.9982  7.45725  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -196.199  10.9982  7.45725  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -143.114  10.9982  7.45725  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2256 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -157.943  10.9982  7.45725  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -153.918  10.9982  7.45725  0.31955
protocols.relax.FastRelax: {0} CMD: min  -175.073  11.1507  7.92721  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -175.073  11.1507  7.92721  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -123.788  11.1507  7.92721  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2190 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -124.197  11.1507  7.92721  0.55
protocols.relax.FastRelax: {0} CMD: min  -179.339  11.8498  8.08681  0.55
protocols.relax.FastRelax: {0} MRP: 0  -179.339  -179.339  11.8498  8.08681
protocols.relax.FastRelax: {0} CMD: accept_to_best  -179.339  11.8498  8.08681  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -179.339  11.8498  8.08681  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -179.339  11.8498  8.08681  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -243.979  11.8498  8.08681  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2217 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -259.095  11.8498  8.08681  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -257.265  11.8498  8.08681  0.02805
protocols.relax.FastRelax: {0} CMD: min  -298.839  11.8801  8.16583  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -298.839  11.8801  8.16583  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -188.276  11.8801  8.16583  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2339 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -201.704  11.8801  8.16583  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -195.479  11.8801  8.16583  0.154
protocols.relax.FastRelax: {0} CMD: min  -243.308  11.9494  8.19213  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -243.308  11.9494  8.19213  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -198.75  11.9494  8.19213  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2225 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -199.654  11.9494  8.19213  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -196.341  11.9494  8.19213  0.31955
protocols.relax.FastRelax: {0} CMD: min  -209.435  11.8626  8.15765  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -209.435  11.8626  8.15765  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -168.439  11.8626  8.15765  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2012 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -168.529  11.8626  8.15765  0.55
protocols.relax.FastRelax: {0} CMD: min  -189.549  11.8158  8.07279  0.55
protocols.relax.FastRelax: {0} MRP: 1  -189.549  -189.549  11.8158  8.07279
protocols.relax.FastRelax: {0} CMD: accept_to_best  -189.549  11.8158  8.07279  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -189.549  11.8158  8.07279  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -189.549  11.8158  8.07279  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -254.37  11.8158  8.07279  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2229 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -261.357  11.8158  8.07279  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -259.828  11.8158  8.07279  0.02805
protocols.relax.FastRelax: {0} CMD: min  -296.762  11.8523  8.23335  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -296.762  11.8523  8.23335  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -198.164  11.8523  8.23335  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2309 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -214.322  11.8523  8.23335  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -208.929  11.8523  8.23335  0.154
protocols.relax.FastRelax: {0} CMD: min  -252.092  11.8004  8.1238  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -252.092  11.8004  8.1238  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -212.898  11.8004  8.1238  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2130 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -213.728  11.8004  8.1238  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -210.698  11.8004  8.1238  0.31955
protocols.relax.FastRelax: {0} CMD: min  -218.781  11.7042  8.11238  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -218.781  11.7042  8.11238  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -175.458  11.7042  8.11238  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2085 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -176.424  11.7042  8.11238  0.55
protocols.relax.FastRelax: {0} CMD: min  -194.366  11.7088  8.07493  0.55
protocols.relax.FastRelax: {0} MRP: 2  -194.366  -194.366  11.7088  8.07493
protocols.relax.FastRelax: {0} CMD: accept_to_best  -194.366  11.7088  8.07493  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -194.366  11.7088  8.07493  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -194.366  11.7088  8.07493  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -260.723  11.7088  8.07493  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2213 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -266.941  11.7088  8.07493  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -265.289  11.7088  8.07493  0.02805
protocols.relax.FastRelax: {0} CMD: min  -307.809  11.6683  8.14756  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -307.809  11.6683  8.14756  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -203.598  11.6683  8.14756  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2355 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -220.068  11.6683  8.14756  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -215.114  11.6683  8.14756  0.154
protocols.relax.FastRelax: {0} CMD: min  -248.262  11.7443  8.12428  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -248.262  11.7443  8.12428  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -207.27  11.7443  8.12428  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2137 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -208.048  11.7443  8.12428  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -204.869  11.7443  8.12428  0.31955
protocols.relax.FastRelax: {0} CMD: min  -216.069  11.7232  8.11088  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -216.069  11.7232  8.11088  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -176.498  11.7232  8.11088  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2109 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -174.486  11.7232  8.11088  0.55
protocols.relax.FastRelax: {0} CMD: min  -196.455  10.812  8.08101  0.55
protocols.relax.FastRelax: {0} MRP: 3  -196.455  -196.455  10.812  8.08101
protocols.relax.FastRelax: {0} CMD: accept_to_best  -196.455  10.812  8.08101  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -196.455  10.812  8.08101  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -196.455  10.812  8.08101  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -262.196  10.812  8.08101  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2209 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -273.455  10.812  8.08101  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -271.45  10.812  8.08101  0.02805
protocols.relax.FastRelax: {0} CMD: min  -316.511  10.9469  8.24794  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -316.511  10.9469  8.24794  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -190.729  10.9469  8.24794  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2381 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -211.491  10.9469  8.24794  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -206.384  10.9469  8.24794  0.154
protocols.relax.FastRelax: {0} CMD: min  -242.714  10.9069  8.20839  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -242.714  10.9069  8.20839  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -198.856  10.9069  8.20839  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2224 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -201.78  10.9069  8.20839  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -198.515  10.9069  8.20839  0.31955
protocols.relax.FastRelax: {0} CMD: min  -210.558  10.9969  8.25927  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -210.558  10.9969  8.25927  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -166.222  10.9969  8.25927  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2164 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -166.27  10.9969  8.25927  0.55
protocols.relax.FastRelax: {0} CMD: min  -193.703  10.6566  8.57974  0.55
protocols.relax.FastRelax: {0} MRP: 4  -193.703  -196.455  10.812  8.08101
protocols.relax.FastRelax: {0} CMD: accept_to_best  -193.703  10.6566  8.57974  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -193.703  10.6566  8.57974  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_30.pdb
protocols.relax.FastRelax: {0} CMD: repeat  72615.7  12.9121  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  72615.7  12.9121  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7056.38  12.9121  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3540 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -155.588  12.9121  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -133.719  12.9121  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -290.716  12.4553  2.80568  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -290.716  12.4553  2.80568  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -161.337  12.4553  2.80568  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3182 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -186.505  12.4553  2.80568  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -179.395  12.4553  2.80568  0.154
protocols.relax.FastRelax: {0} CMD: min  -238.247  12.5812  2.38521  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -238.247  12.5812  2.38521  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -191.345  12.5812  2.38521  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2930 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -195.46  12.5812  2.38521  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -191.918  12.5812  2.38521  0.31955
protocols.relax.FastRelax: {0} CMD: min  -202.331  12.6565  2.13594  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -202.331  12.6565  2.13594  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -148.634  12.6565  2.13594  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2728 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -149.723  12.6565  2.13594  0.55
protocols.relax.FastRelax: {0} CMD: min  -220.672  12.4885  3.62297  0.55
protocols.relax.FastRelax: {0} MRP: 0  -220.672  -220.672  12.4885  3.62297
protocols.relax.FastRelax: {0} CMD: accept_to_best  -220.672  12.4885  3.62297  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -220.672  12.4885  3.62297  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -220.672  12.4885  3.62297  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -280.647  12.4885  3.62297  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3175 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -301.352  12.4885  3.62297  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -297.386  12.4885  3.62297  0.02805
protocols.relax.FastRelax: {0} CMD: min  -348.898  12.3825  3.92347  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -348.898  12.3825  3.92347  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -203.452  12.3825  3.92347  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3539 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -231.656  12.3825  3.92347  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -224.229  12.3825  3.92347  0.154
protocols.relax.FastRelax: {0} CMD: min  -291.029  12.4467  3.73193  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -291.029  12.4467  3.73193  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -249.563  12.4467  3.73193  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3114 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -249.94  12.4467  3.73193  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -246.683  12.4467  3.73193  0.31955
protocols.relax.FastRelax: {0} CMD: min  -252.748  12.4646  3.66924  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -252.748  12.4646  3.66924  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -206.436  12.4646  3.66924  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2840 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -207.744  12.4646  3.66924  0.55
protocols.relax.FastRelax: {0} CMD: min  -246.422  12.6235  3.56412  0.55
protocols.relax.FastRelax: {0} MRP: 1  -246.422  -246.422  12.6235  3.56412
protocols.relax.FastRelax: {0} CMD: accept_to_best  -246.422  12.6235  3.56412  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -246.422  12.6235  3.56412  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -246.422  12.6235  3.56412  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -305.279  12.6235  3.56412  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3508 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -321.718  12.6235  3.56412  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -319.239  12.6235  3.56412  0.02805
protocols.relax.FastRelax: {0} CMD: min  -362.815  12.4414  4.10394  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -362.815  12.4414  4.10394  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -247.551  12.4414  4.10394  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3805 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -270.986  12.4414  4.10394  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -265.73  12.4414  4.10394  0.154
protocols.relax.FastRelax: {0} CMD: min  -302.911  12.5871  3.74725  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -302.911  12.5871  3.74725  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -259.395  12.5871  3.74725  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3279 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -260.34  12.5871  3.74725  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -256.958  12.5871  3.74725  0.31955
protocols.relax.FastRelax: {0} CMD: min  -271.966  12.5864  3.64186  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -271.966  12.5864  3.64186  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -231.695  12.5864  3.64186  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3078 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -231.932  12.5864  3.64186  0.55
protocols.relax.FastRelax: {0} CMD: min  -251.079  12.6249  3.61588  0.55
protocols.relax.FastRelax: {0} MRP: 2  -251.079  -251.079  12.6249  3.61588
protocols.relax.FastRelax: {0} CMD: accept_to_best  -251.079  12.6249  3.61588  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -251.079  12.6249  3.61588  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -251.079  12.6249  3.61588  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -310.693  12.6249  3.61588  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3333 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -324.839  12.6249  3.61588  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -322.561  12.6249  3.61588  0.02805
protocols.relax.FastRelax: {0} CMD: min  -357.545  12.5091  4.2618  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -357.545  12.5091  4.2618  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -223.961  12.5091  4.2618  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3490 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -256.415  12.5091  4.2618  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -250.615  12.5091  4.2618  0.154
protocols.relax.FastRelax: {0} CMD: min  -300.671  12.5723  3.68204  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -300.671  12.5723  3.68204  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -260.139  12.5723  3.68204  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3230 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -260.565  12.5723  3.68204  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -257.393  12.5723  3.68204  0.31955
protocols.relax.FastRelax: {0} CMD: min  -273.03  12.5993  3.61302  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -273.03  12.5993  3.61302  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -235.449  12.5993  3.61302  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2858 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -235.643  12.5993  3.61302  0.55
protocols.relax.FastRelax: {0} CMD: min  -255.668  12.6259  3.79384  0.55
protocols.relax.FastRelax: {0} MRP: 3  -255.668  -255.668  12.6259  3.79384
protocols.relax.FastRelax: {0} CMD: accept_to_best  -255.668  12.6259  3.79384  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -255.668  12.6259  3.79384  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -255.668  12.6259  3.79384  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -315.884  12.6259  3.79384  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3584 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -322.708  12.6259  3.79384  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -319.098  12.6259  3.79384  0.02805
protocols.relax.FastRelax: {0} CMD: min  -362.651  12.5853  4.41052  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -362.651  12.5853  4.41052  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -235.517  12.5853  4.41052  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3765 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -275.003  12.5853  4.41052  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -269.775  12.5853  4.41052  0.154
protocols.relax.FastRelax: {0} CMD: min  -306.551  12.6006  4.33008  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -306.551  12.6006  4.33008  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -263.244  12.6006  4.33008  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3425 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -265.573  12.6006  4.33008  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -262.303  12.6006  4.33008  0.31955
protocols.relax.FastRelax: {0} CMD: min  -275.696  12.578  4.08028  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -275.696  12.578  4.08028  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -234.91  12.578  4.08028  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3081 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -235.08  12.578  4.08028  0.55
protocols.relax.FastRelax: {0} CMD: min  -255.883  12.6334  3.94598  0.55
protocols.relax.FastRelax: {0} MRP: 4  -255.883  -255.883  12.6334  3.94598
protocols.relax.FastRelax: {0} CMD: accept_to_best  -255.883  12.6334  3.94598  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -255.883  12.6334  3.94598  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_40.pdb
protocols.relax.FastRelax: {0} CMD: repeat  71903.9  14.8492  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  71903.9  14.8492  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7073.63  14.8492  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2746 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -84.1562  14.8492  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -55.0317  14.8492  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -250.442  14.6216  3.83477  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -250.442  14.6216  3.83477  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -85.9905  14.6216  3.83477  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2863 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -130.762  14.6216  3.83477  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -122.848  14.6216  3.83477  0.154
protocols.relax.FastRelax: {0} CMD: min  -238.477  14.7296  5.43467  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -238.477  14.7296  5.43467  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -196.087  14.7296  5.43467  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2842 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -197.258  14.7296  5.43467  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -193.944  14.7296  5.43467  0.31955
protocols.relax.FastRelax: {0} CMD: min  -212.844  14.7258  5.50318  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -212.844  14.7258  5.50318  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -173.588  14.7258  5.50318  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2543 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -174.12  14.7258  5.50318  0.55
protocols.relax.FastRelax: {0} CMD: min  -215.221  14.7104  5.4128  0.55
protocols.relax.FastRelax: {0} MRP: 0  -215.221  -215.221  14.7104  5.4128
protocols.relax.FastRelax: {0} CMD: accept_to_best  -215.221  14.7104  5.4128  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -215.221  14.7104  5.4128  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -215.221  14.7104  5.4128  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -277.321  14.7104  5.4128  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2789 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -284.549  14.7104  5.4128  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -283.003  14.7104  5.4128  0.02805
protocols.relax.FastRelax: {0} CMD: min  -331.091  14.5623  5.68235  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -331.091  14.5623  5.68235  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -204.364  14.5623  5.68235  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3055 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -222.141  14.5623  5.68235  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -215.091  14.5623  5.68235  0.154
protocols.relax.FastRelax: {0} CMD: min  -275.129  14.671  5.42351  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -275.129  14.671  5.42351  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -234.726  14.671  5.42351  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2825 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -235.922  14.671  5.42351  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -232.784  14.671  5.42351  0.31955
protocols.relax.FastRelax: {0} CMD: min  -243.056  14.6653  5.3129  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -243.056  14.6653  5.3129  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -202.247  14.6653  5.3129  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2614 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -202.249  14.6653  5.3129  0.55
protocols.relax.FastRelax: {0} CMD: min  -226.033  14.7113  5.3303  0.55
protocols.relax.FastRelax: {0} MRP: 1  -226.033  -226.033  14.7113  5.3303
protocols.relax.FastRelax: {0} CMD: accept_to_best  -226.033  14.7113  5.3303  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -226.033  14.7113  5.3303  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -226.033  14.7113  5.3303  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -289.73  14.7113  5.3303  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2881 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -295.234  14.7113  5.3303  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -293.318  14.7113  5.3303  0.02805
protocols.relax.FastRelax: {0} CMD: min  -347.411  14.8068  5.46957  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -347.411  14.8068  5.46957  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -216.744  14.8068  5.46957  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3044 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -229.552  14.8068  5.46957  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -222.62  14.8068  5.46957  0.154
protocols.relax.FastRelax: {0} CMD: min  -278.899  14.7892  5.39659  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -278.899  14.7892  5.39659  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -235.988  14.7892  5.39659  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2885 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -238.755  14.7892  5.39659  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -235.335  14.7892  5.39659  0.31955
protocols.relax.FastRelax: {0} CMD: min  -246.689  14.775  5.34713  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -246.689  14.775  5.34713  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -202.645  14.775  5.34713  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2593 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -203.015  14.775  5.34713  0.55
protocols.relax.FastRelax: {0} CMD: min  -227.123  14.7633  5.30809  0.55
protocols.relax.FastRelax: {0} MRP: 2  -227.123  -227.123  14.7633  5.30809
protocols.relax.FastRelax: {0} CMD: accept_to_best  -227.123  14.7633  5.30809  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -227.123  14.7633  5.30809  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -227.123  14.7633  5.30809  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -291.378  14.7633  5.30809  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2852 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -299.731  14.7633  5.30809  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -298.127  14.7633  5.30809  0.02805
protocols.relax.FastRelax: {0} CMD: min  -353.781  14.8359  5.43792  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -353.781  14.8359  5.43792  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -220.97  14.8359  5.43792  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3063 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -228.972  14.8359  5.43792  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -220.899  14.8359  5.43792  0.154
protocols.relax.FastRelax: {0} CMD: min  -290.672  14.8223  5.34224  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -290.672  14.8223  5.34224  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -247.726  14.8223  5.34224  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2771 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -248.235  14.8223  5.34224  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -244.846  14.8223  5.34224  0.31955
protocols.relax.FastRelax: {0} CMD: min  -257.211  14.7716  5.33594  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -257.211  14.7716  5.33594  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -215.288  14.7716  5.33594  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2506 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -215.309  14.7716  5.33594  0.55
protocols.relax.FastRelax: {0} CMD: min  -229.526  14.7561  5.24976  0.55
protocols.relax.FastRelax: {0} MRP: 3  -229.526  -229.526  14.7561  5.24976
protocols.relax.FastRelax: {0} CMD: accept_to_best  -229.526  14.7561  5.24976  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -229.526  14.7561  5.24976  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -229.526  14.7561  5.24976  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -294.733  14.7561  5.24976  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2844 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -301.576  14.7561  5.24976  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -299.997  14.7561  5.24976  0.02805
protocols.relax.FastRelax: {0} CMD: min  -354.544  14.8567  5.47074  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -354.544  14.8567  5.47074  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -227.397  14.8567  5.47074  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3150 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -238.25  14.8567  5.47074  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -230.72  14.8567  5.47074  0.154
protocols.relax.FastRelax: {0} CMD: min  -289.635  14.8335  5.38647  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -289.635  14.8335  5.38647  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -242.502  14.8335  5.38647  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2906 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -243.475  14.8335  5.38647  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -239.747  14.8335  5.38647  0.31955
protocols.relax.FastRelax: {0} CMD: min  -257.485  14.8052  5.32501  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -257.485  14.8052  5.32501  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -216.404  14.8052  5.32501  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2578 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -217.536  14.8052  5.32501  0.55
protocols.relax.FastRelax: {0} CMD: min  -233.236  14.7575  5.25943  0.55
protocols.relax.FastRelax: {0} MRP: 4  -233.236  -233.236  14.7575  5.25943
protocols.relax.FastRelax: {0} CMD: accept_to_best  -233.236  14.7575  5.25943  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -233.236  14.7575  5.25943  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_6.pdb
protocols.relax.FastRelax: {0} CMD: repeat  68008.4  15.7832  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  68008.4  15.7832  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  6453.43  15.7832  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2861 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  3.30326  15.7832  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  65.1045  15.7832  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -234.153  16.6524  4.59712  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -234.153  16.6524  4.59712  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -83.2312  16.6524  4.59712  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2505 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -130.359  16.6524  4.59712  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -123.772  16.6524  4.59712  0.154
protocols.relax.FastRelax: {0} CMD: min  -204.721  16.6383  3.79295  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -204.721  16.6383  3.79295  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -163.673  16.6383  3.79295  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2607 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -165.812  16.6383  3.79295  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -162.607  16.6383  3.79295  0.31955
protocols.relax.FastRelax: {0} CMD: min  -172.388  17.0295  3.99202  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -172.388  17.0295  3.99202  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -129.252  17.0295  3.99202  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2559 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -133.633  17.0295  3.99202  0.55
protocols.relax.FastRelax: {0} CMD: min  -179.794  17.1712  4.16619  0.55
protocols.relax.FastRelax: {0} MRP: 0  -179.794  -179.794  17.1712  4.16619
protocols.relax.FastRelax: {0} CMD: accept_to_best  -179.794  17.1712  4.16619  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -179.794  17.1712  4.16619  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -179.794  17.1712  4.16619  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -245.129  17.1712  4.16619  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2893 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -259.958  17.1712  4.16619  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -256.306  17.1712  4.16619  0.02805
protocols.relax.FastRelax: {0} CMD: min  -312.685  17.2959  4.43264  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -312.685  17.2959  4.43264  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -186.782  17.2959  4.43264  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2969 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -202.694  17.2959  4.43264  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -195.714  17.2959  4.43264  0.154
protocols.relax.FastRelax: {0} CMD: min  -248.913  17.2786  4.33612  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -248.913  17.2786  4.33612  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -202.43  17.2786  4.33612  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2856 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -202.698  17.2786  4.33612  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -199.066  17.2786  4.33612  0.31955
protocols.relax.FastRelax: {0} CMD: min  -213.177  17.2978  4.40494  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -213.177  17.2978  4.40494  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -169.929  17.2978  4.40494  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2716 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -170.297  17.2978  4.40494  0.55
protocols.relax.FastRelax: {0} CMD: min  -195.25  17.4209  4.61412  0.55
protocols.relax.FastRelax: {0} MRP: 1  -195.25  -195.25  17.4209  4.61412
protocols.relax.FastRelax: {0} CMD: accept_to_best  -195.25  17.4209  4.61412  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -195.25  17.4209  4.61412  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -195.25  17.4209  4.61412  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -261.101  17.4209  4.61412  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2905 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -266.842  17.4209  4.61412  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -264.995  17.4209  4.61412  0.02805
protocols.relax.FastRelax: {0} CMD: min  -322.184  17.4386  4.60667  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -322.184  17.4386  4.60667  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -189.849  17.4386  4.60667  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2963 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -208.916  17.4386  4.60667  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -201.819  17.4386  4.60667  0.154
protocols.relax.FastRelax: {0} CMD: min  -254.979  17.5052  4.63566  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -254.979  17.5052  4.63566  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -206.188  17.5052  4.63566  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2890 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -207.272  17.5052  4.63566  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -203.486  17.5052  4.63566  0.31955
protocols.relax.FastRelax: {0} CMD: min  -221.756  17.538  4.73395  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -221.756  17.538  4.73395  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -178.639  17.538  4.73395  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2781 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -179.04  17.538  4.73395  0.55
protocols.relax.FastRelax: {0} CMD: min  -199.866  17.5094  4.9055  0.55
protocols.relax.FastRelax: {0} MRP: 2  -199.866  -199.866  17.5094  4.9055
protocols.relax.FastRelax: {0} CMD: accept_to_best  -199.866  17.5094  4.9055  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -199.866  17.5094  4.9055  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -199.866  17.5094  4.9055  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -265.472  17.5094  4.9055  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3156 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -270.493  17.5094  4.9055  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -268.795  17.5094  4.9055  0.02805
protocols.relax.FastRelax: {0} CMD: min  -333.171  17.5328  5.03258  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -333.171  17.5328  5.03258  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -199.181  17.5328  5.03258  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3075 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -214.802  17.5328  5.03258  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -207.082  17.5328  5.03258  0.154
protocols.relax.FastRelax: {0} CMD: min  -269.589  17.6505  5.12332  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -269.589  17.6505  5.12332  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -222.766  17.6505  5.12332  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2846 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -224.129  17.6505  5.12332  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -220.419  17.6505  5.12332  0.31955
protocols.relax.FastRelax: {0} CMD: min  -232.745  17.6776  5.17943  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -232.745  17.6776  5.17943  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -186.316  17.6776  5.17943  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2823 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -186.528  17.6776  5.17943  0.55
protocols.relax.FastRelax: {0} CMD: min  -208.761  17.7023  5.40449  0.55
protocols.relax.FastRelax: {0} MRP: 3  -208.761  -208.761  17.7023  5.40449
protocols.relax.FastRelax: {0} CMD: accept_to_best  -208.761  17.7023  5.40449  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -208.761  17.7023  5.40449  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -208.761  17.7023  5.40449  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -276.593  17.7023  5.40449  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3137 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -282.386  17.7023  5.40449  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -280.568  17.7023  5.40449  0.02805
protocols.relax.FastRelax: {0} CMD: min  -343.18  17.6638  5.36917  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -343.18  17.6638  5.36917  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -209.76  17.6638  5.36917  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3057 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -225.218  17.6638  5.36917  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -217.502  17.6638  5.36917  0.154
protocols.relax.FastRelax: {0} CMD: min  -273.833  17.7033  5.39718  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -273.833  17.7033  5.39718  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -223.53  17.7033  5.39718  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3006 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -223.762  17.7033  5.39718  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -219.856  17.7033  5.39718  0.31955
protocols.relax.FastRelax: {0} CMD: min  -235.686  17.7301  5.42525  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -235.686  17.7301  5.42525  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -191.64  17.7301  5.42525  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2859 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -192.437  17.7301  5.42525  0.55
protocols.relax.FastRelax: {0} CMD: min  -210.982  17.7111  5.52371  0.55
protocols.relax.FastRelax: {0} MRP: 4  -210.982  -210.982  17.7111  5.52371
protocols.relax.FastRelax: {0} CMD: accept_to_best  -210.982  17.7111  5.52371  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -210.982  17.7111  5.52371  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_26.pdb
protocols.relax.FastRelax: {0} CMD: repeat  79539.6  13.614  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  79539.6  13.614  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7481.47  13.614  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2664 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -32.3169  13.614  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  22.2352  13.614  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -232.538  13.3012  2.33148  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -232.538  13.3012  2.33148  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -9.2245  13.3012  2.33148  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2690 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -81.459  13.3012  2.33148  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -70.9821  13.3012  2.33148  0.154
protocols.relax.FastRelax: {0} CMD: min  -205.894  13.1956  3.07785  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -205.894  13.1956  3.07785  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -155.529  13.1956  3.07785  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2579 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -157.627  13.1956  3.07785  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -153.838  13.1956  3.07785  0.31955
protocols.relax.FastRelax: {0} CMD: min  -176.777  12.9834  4.18465  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -176.777  12.9834  4.18465  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -129.02  12.9834  4.18465  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2453 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -133.808  12.9834  4.18465  0.55
protocols.relax.FastRelax: {0} CMD: min  -196.287  12.7808  4.1374  0.55
protocols.relax.FastRelax: {0} MRP: 0  -196.287  -196.287  12.7808  4.1374
protocols.relax.FastRelax: {0} CMD: accept_to_best  -196.287  12.7808  4.1374  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -196.287  12.7808  4.1374  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -196.287  12.7808  4.1374  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -266.433  12.7808  4.1374  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2882 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -288.048  12.7808  4.1374  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -282.5  12.7808  4.1374  0.02805
protocols.relax.FastRelax: {0} CMD: min  -323.328  12.5031  4.30494  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -323.328  12.5031  4.30494  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -185.718  12.5031  4.30494  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2693 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -221.275  12.5031  4.30494  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -215.258  12.5031  4.30494  0.154
protocols.relax.FastRelax: {0} CMD: min  -260.454  12.5595  4.54602  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -260.454  12.5595  4.54602  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -216.298  12.5595  4.54602  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2487 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -218.494  12.5595  4.54602  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -215.037  12.5595  4.54602  0.31955
protocols.relax.FastRelax: {0} CMD: min  -229.862  12.5905  4.90225  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -229.862  12.5905  4.90225  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -184.811  12.5905  4.90225  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2440 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -184.782  12.5905  4.90225  0.55
protocols.relax.FastRelax: {0} CMD: min  -217.151  12.3186  6.20765  0.55
protocols.relax.FastRelax: {0} MRP: 1  -217.151  -217.151  12.3186  6.20765
protocols.relax.FastRelax: {0} CMD: accept_to_best  -217.151  12.3186  6.20765  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -217.151  12.3186  6.20765  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -217.151  12.3186  6.20765  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -286.514  12.3186  6.20765  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2922 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -302.209  12.3186  6.20765  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -298.578  12.3186  6.20765  0.02805
protocols.relax.FastRelax: {0} CMD: min  -317.634  12.1707  6.092  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -317.634  12.1707  6.092  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -210.143  12.1707  6.092  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2777 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -260.55  12.1707  6.092  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -257.039  12.1707  6.092  0.154
protocols.relax.FastRelax: {0} CMD: min  -279.049  12.1888  6.0173  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -279.049  12.1888  6.0173  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -237.47  12.1888  6.0173  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2691 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -238.286  12.1888  6.0173  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -235.126  12.1888  6.0173  0.31955
protocols.relax.FastRelax: {0} CMD: min  -246.787  12.2498  6.11624  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -246.787  12.2498  6.11624  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -205.201  12.2498  6.11624  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2677 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -205.333  12.2498  6.11624  0.55
protocols.relax.FastRelax: {0} CMD: min  -225.093  12.2809  6.46855  0.55
protocols.relax.FastRelax: {0} MRP: 2  -225.093  -225.093  12.2809  6.46855
protocols.relax.FastRelax: {0} CMD: accept_to_best  -225.093  12.2809  6.46855  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -225.093  12.2809  6.46855  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -225.093  12.2809  6.46855  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -294.308  12.2809  6.46855  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3028 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -305.254  12.2809  6.46855  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -302.746  12.2809  6.46855  0.02805
protocols.relax.FastRelax: {0} CMD: min  -342.53  12.0252  6.14736  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -342.53  12.0252  6.14736  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -210.932  12.0252  6.14736  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3018 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -233.766  12.0252  6.14736  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -226.696  12.0252  6.14736  0.154
protocols.relax.FastRelax: {0} CMD: min  -284.343  12.168  6.21994  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -284.343  12.168  6.21994  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -241.125  12.168  6.21994  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2772 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -242.23  12.168  6.21994  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -238.807  12.168  6.21994  0.31955
protocols.relax.FastRelax: {0} CMD: min  -253.639  12.2373  6.52332  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -253.639  12.2373  6.52332  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -210.908  12.2373  6.52332  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2651 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -211.139  12.2373  6.52332  0.55
protocols.relax.FastRelax: {0} CMD: min  -226.916  12.2266  6.7532  0.55
protocols.relax.FastRelax: {0} MRP: 3  -226.916  -226.916  12.2266  6.7532
protocols.relax.FastRelax: {0} CMD: accept_to_best  -226.916  12.2266  6.7532  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -226.916  12.2266  6.7532  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -226.916  12.2266  6.7532  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -295.709  12.2266  6.7532  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3014 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -306.871  12.2266  6.7532  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -303.552  12.2266  6.7532  0.02805
protocols.relax.FastRelax: {0} CMD: min  -340.263  11.9611  6.12538  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -340.263  11.9611  6.12538  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -242.774  11.9611  6.12538  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2934 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -257.973  11.9611  6.12538  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -252.794  11.9611  6.12538  0.154
protocols.relax.FastRelax: {0} CMD: min  -286.572  12.0482  6.4003  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -286.572  12.0482  6.4003  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -245.448  12.0482  6.4003  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2798 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -245.721  12.0482  6.4003  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -242.519  12.0482  6.4003  0.31955
protocols.relax.FastRelax: {0} CMD: min  -252.359  12.14  6.44681  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -252.359  12.14  6.44681  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -207.832  12.14  6.44681  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2735 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -208.008  12.14  6.44681  0.55
protocols.relax.FastRelax: {0} CMD: min  -226.735  12.2127  6.72598  0.55
protocols.relax.FastRelax: {0} MRP: 4  -226.735  -226.916  12.2266  6.7532
protocols.relax.FastRelax: {0} CMD: accept_to_best  -226.735  12.2127  6.72598  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -226.735  12.2127  6.72598  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_49.pdb
protocols.relax.FastRelax: {0} CMD: repeat  61221.8  15.5307  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  61221.8  15.5307  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7136.81  15.5307  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2188 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  130.739  15.5307  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  150.768  15.5307  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  1719.81  16.5262  9.06134  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  1719.81  16.5262  9.06134  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  10971.5  16.5262  9.06134  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2981 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  7157.84  16.5262  9.06134  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7586.66  16.5262  9.06134  0.154
protocols.relax.FastRelax: {0} CMD: min  -153.87  15.8684  14.3549  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -153.87  15.8684  14.3549  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -116.556  15.8684  14.3549  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2098 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -151.74  15.8684  14.3549  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -149.431  15.8684  14.3549  0.31955
protocols.relax.FastRelax: {0} CMD: min  -184.998  14.7998  10.5641  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -184.998  14.7998  10.5641  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -152.104  14.7998  10.5641  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2040 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -155.366  14.7998  10.5641  0.55
protocols.relax.FastRelax: {0} CMD: min  -198.806  14.567  9.10449  0.55
protocols.relax.FastRelax: {0} MRP: 0  -198.806  -198.806  14.567  9.10449
protocols.relax.FastRelax: {0} CMD: accept_to_best  -198.806  14.567  9.10449  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -198.806  14.567  9.10449  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -198.806  14.567  9.10449  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -253.603  14.567  9.10449  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2250 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -260.612  14.567  9.10449  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -256.928  14.567  9.10449  0.02805
protocols.relax.FastRelax: {0} CMD: min  -297.481  14.6303  8.54667  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -297.481  14.6303  8.54667  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -189.436  14.6303  8.54667  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2220 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -224.501  14.6303  8.54667  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -220.849  14.6303  8.54667  0.154
protocols.relax.FastRelax: {0} CMD: min  -254.306  14.6383  8.33007  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -254.306  14.6383  8.33007  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -222.779  14.6383  8.33007  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2167 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -224.006  14.6383  8.33007  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -221.545  14.6383  8.33007  0.31955
protocols.relax.FastRelax: {0} CMD: min  -225.698  14.6182  8.33742  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -225.698  14.6182  8.33742  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -184.134  14.6182  8.33742  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2121 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -184.629  14.6182  8.33742  0.55
protocols.relax.FastRelax: {0} CMD: min  -223.903  14.5604  8.32978  0.55
protocols.relax.FastRelax: {0} MRP: 1  -223.903  -223.903  14.5604  8.32978
protocols.relax.FastRelax: {0} CMD: accept_to_best  -223.903  14.5604  8.32978  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -223.903  14.5604  8.32978  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -223.903  14.5604  8.32978  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -280.699  14.5604  8.32978  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2361 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -291.687  14.5604  8.32978  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -288.944  14.5604  8.32978  0.02805
protocols.relax.FastRelax: {0} CMD: min  -323.076  14.7319  8.24242  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -323.076  14.7319  8.24242  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -224.773  14.7319  8.24242  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2425 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -247.439  14.7319  8.24242  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -243.372  14.7319  8.24242  0.154
protocols.relax.FastRelax: {0} CMD: min  -275.883  14.7515  8.17262  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -275.883  14.7515  8.17262  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -242.324  14.7515  8.17262  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2367 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -243.291  14.7515  8.17262  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -240.708  14.7515  8.17262  0.31955
protocols.relax.FastRelax: {0} CMD: min  -246.771  14.7434  8.16527  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -246.771  14.7434  8.16527  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -210.215  14.7434  8.16527  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2289 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -210.249  14.7434  8.16527  0.55
protocols.relax.FastRelax: {0} CMD: min  -229.689  14.7794  7.77432  0.55
protocols.relax.FastRelax: {0} MRP: 2  -229.689  -229.689  14.7794  7.77432
protocols.relax.FastRelax: {0} CMD: accept_to_best  -229.689  14.7794  7.77432  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -229.689  14.7794  7.77432  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -229.689  14.7794  7.77432  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -286.543  14.7794  7.77432  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2478 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -299.68  14.7794  7.77432  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -296.278  14.7794  7.77432  0.02805
protocols.relax.FastRelax: {0} CMD: min  -335.125  15.0513  7.6723  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -335.125  15.0513  7.6723  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -232.293  15.0513  7.6723  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2435 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -263.478  15.0513  7.6723  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -259.377  15.0513  7.6723  0.154
protocols.relax.FastRelax: {0} CMD: min  -292.15  15.0371  7.42321  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -292.15  15.0371  7.42321  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -256.354  15.0371  7.42321  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2263 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -256.849  15.0371  7.42321  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -254.085  15.0371  7.42321  0.31955
protocols.relax.FastRelax: {0} CMD: min  -256.981  15.0262  7.40411  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -256.981  15.0262  7.40411  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -210.86  15.0262  7.40411  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2229 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -209.477  15.0262  7.40411  0.55
protocols.relax.FastRelax: {0} CMD: min  -242.289  14.9461  7.14894  0.55
protocols.relax.FastRelax: {0} MRP: 3  -242.289  -242.289  14.9461  7.14894
protocols.relax.FastRelax: {0} CMD: accept_to_best  -242.289  14.9461  7.14894  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -242.289  14.9461  7.14894  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -242.289  14.9461  7.14894  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -301.838  14.9461  7.14894  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2530 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -315.332  14.9461  7.14894  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -311.055  14.9461  7.14894  0.02805
protocols.relax.FastRelax: {0} CMD: min  -353.109  14.9641  7.54853  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -353.109  14.9641  7.54853  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -186.822  14.9641  7.54853  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2578 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -224.74  14.9641  7.54853  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -216.9  14.9641  7.54853  0.154
protocols.relax.FastRelax: {0} CMD: min  -301.785  14.9201  7.29351  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -301.785  14.9201  7.29351  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -261.576  14.9201  7.29351  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2249 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -262.228  14.9201  7.29351  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -259.125  14.9201  7.29351  0.31955
protocols.relax.FastRelax: {0} CMD: min  -271.329  14.9261  7.21037  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -271.329  14.9261  7.21037  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -231.737  14.9261  7.21037  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2243 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -231.966  14.9261  7.21037  0.55
protocols.relax.FastRelax: {0} CMD: min  -246.439  14.8314  7.15191  0.55
protocols.relax.FastRelax: {0} MRP: 4  -246.439  -246.439  14.8314  7.15191
protocols.relax.FastRelax: {0} CMD: accept_to_best  -246.439  14.8314  7.15191  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -246.439  14.8314  7.15191  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_1.pdb
protocols.relax.FastRelax: {0} CMD: repeat  69468.1  16.4476  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  69468.1  16.4476  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7376.15  16.4476  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2366 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  75.3502  16.4476  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  89.095  16.4476  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -229.794  16.9424  3.7743  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -229.794  16.9424  3.7743  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  211.849  16.9424  3.7743  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3295 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -92.5068  16.9424  3.7743  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -80.2434  16.9424  3.7743  0.154
protocols.relax.FastRelax: {0} CMD: min  -236.663  16.7285  3.8467  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -236.663  16.7285  3.8467  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -185.125  16.7285  3.8467  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2919 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -191.035  16.7285  3.8467  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -187.008  16.7285  3.8467  0.31955
protocols.relax.FastRelax: {0} CMD: min  -200.425  16.7439  3.74764  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -200.425  16.7439  3.74764  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -147.095  16.7439  3.74764  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2795 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -146.782  16.7439  3.74764  0.55
protocols.relax.FastRelax: {0} CMD: min  -208.726  16.7213  4.42109  0.55
protocols.relax.FastRelax: {0} MRP: 0  -208.726  -208.726  16.7213  4.42109
protocols.relax.FastRelax: {0} CMD: accept_to_best  -208.726  16.7213  4.42109  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -208.726  16.7213  4.42109  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -208.726  16.7213  4.42109  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -275.211  16.7213  4.42109  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2783 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -293.865  16.7213  4.42109  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -291.515  16.7213  4.42109  0.02805
protocols.relax.FastRelax: {0} CMD: min  -346.886  16.5977  5.0697  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -346.886  16.5977  5.0697  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -221.295  16.5977  5.0697  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3400 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -239.539  16.5977  5.0697  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -232.963  16.5977  5.0697  0.154
protocols.relax.FastRelax: {0} CMD: min  -287.178  16.6643  4.85306  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -287.178  16.6643  4.85306  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -242.725  16.6643  4.85306  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3002 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -244.316  16.6643  4.85306  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -240.9  16.6643  4.85306  0.31955
protocols.relax.FastRelax: {0} CMD: min  -252.688  16.7029  4.6906  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -252.688  16.7029  4.6906  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -208.431  16.7029  4.6906  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2872 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -202.418  16.7029  4.6906  0.55
protocols.relax.FastRelax: {0} CMD: min  -228.708  16.8285  4.76746  0.55
protocols.relax.FastRelax: {0} MRP: 1  -228.708  -228.708  16.8285  4.76746
protocols.relax.FastRelax: {0} CMD: accept_to_best  -228.708  16.8285  4.76746  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -228.708  16.8285  4.76746  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -228.708  16.8285  4.76746  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -298.458  16.8285  4.76746  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3159 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -310.746  16.8285  4.76746  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -308.902  16.8285  4.76746  0.02805
protocols.relax.FastRelax: {0} CMD: min  -370.698  16.7174  5.64734  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -370.698  16.7174  5.64734  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -219.956  16.7174  5.64734  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3362 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -243.958  16.7174  5.64734  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -236.049  16.7174  5.64734  0.154
protocols.relax.FastRelax: {0} CMD: min  -304.974  16.8272  5.29128  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -304.974  16.8272  5.29128  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -259.03  16.8272  5.29128  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2974 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -259.579  16.8272  5.29128  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -256.062  16.8272  5.29128  0.31955
protocols.relax.FastRelax: {0} CMD: min  -265.406  16.8603  5.22249  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -265.406  16.8603  5.22249  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -217.434  16.8603  5.22249  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2713 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -217.63  16.8603  5.22249  0.55
protocols.relax.FastRelax: {0} CMD: min  -244.113  16.8426  5.20847  0.55
protocols.relax.FastRelax: {0} MRP: 2  -244.113  -244.113  16.8426  5.20847
protocols.relax.FastRelax: {0} CMD: accept_to_best  -244.113  16.8426  5.20847  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -244.113  16.8426  5.20847  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -244.113  16.8426  5.20847  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -314.192  16.8426  5.20847  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2817 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -324.821  16.8426  5.20847  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -322.97  16.8426  5.20847  0.02805
protocols.relax.FastRelax: {0} CMD: min  -367.277  16.6824  5.95802  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -367.277  16.6824  5.95802  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -227.377  16.6824  5.95802  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3280 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -257.88  16.6824  5.95802  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -250.666  16.6824  5.95802  0.154
protocols.relax.FastRelax: {0} CMD: min  -314.992  16.8216  5.77611  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -314.992  16.8216  5.77611  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -268.209  16.8216  5.77611  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2944 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -269.09  16.8216  5.77611  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -265.46  16.8216  5.77611  0.31955
protocols.relax.FastRelax: {0} CMD: min  -277.561  16.8452  5.59036  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -277.561  16.8452  5.59036  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -229.953  16.8452  5.59036  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2655 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -229.993  16.8452  5.59036  0.55
protocols.relax.FastRelax: {0} CMD: min  -252.926  16.901  5.54362  0.55
protocols.relax.FastRelax: {0} MRP: 3  -252.926  -252.926  16.901  5.54362
protocols.relax.FastRelax: {0} CMD: accept_to_best  -252.926  16.901  5.54362  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -252.926  16.901  5.54362  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -252.926  16.901  5.54362  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -324.951  16.901  5.54362  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2997 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -335.827  16.901  5.54362  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -333.604  16.901  5.54362  0.02805
protocols.relax.FastRelax: {0} CMD: min  -388.975  16.7122  6.35561  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -388.975  16.7122  6.35561  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -245.195  16.7122  6.35561  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3548 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -272.231  16.7122  6.35561  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -264.562  16.7122  6.35561  0.154
protocols.relax.FastRelax: {0} CMD: min  -322.371  16.8363  5.90503  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -322.371  16.8363  5.90503  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -271.621  16.8363  5.90503  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3066 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -273.555  16.8363  5.90503  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -269.642  16.8363  5.90503  0.31955
protocols.relax.FastRelax: {0} CMD: min  -284.715  16.892  5.68222  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -284.715  16.892  5.68222  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -237.035  16.892  5.68222  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2677 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -237.241  16.892  5.68222  0.55
protocols.relax.FastRelax: {0} CMD: min  -258.721  16.9278  5.53322  0.55
protocols.relax.FastRelax: {0} MRP: 4  -258.721  -258.721  16.9278  5.53322
protocols.relax.FastRelax: {0} CMD: accept_to_best  -258.721  16.9278  5.53322  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -258.721  16.9278  5.53322  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_46.pdb
protocols.relax.FastRelax: {0} CMD: repeat  70994.7  15.9412  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  70994.7  15.9412  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  6529.94  15.9412  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2592 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -124.55  15.9412  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -104.03  15.9412  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -272.621  14.6986  3.2945  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -272.621  14.6986  3.2945  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -147.728  14.6986  3.2945  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2563 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -172.247  14.6986  3.2945  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -166.368  14.6986  3.2945  0.154
protocols.relax.FastRelax: {0} CMD: min  -202.331  14.4479  3.35829  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -202.331  14.4479  3.35829  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -159.662  14.4479  3.35829  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2398 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -164.328  14.4479  3.35829  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -161.006  14.4479  3.35829  0.31955
protocols.relax.FastRelax: {0} CMD: min  -208.042  14.7586  2.73668  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -208.042  14.7586  2.73668  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -175.37  14.7586  2.73668  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2364 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -176.469  14.7586  2.73668  0.55
protocols.relax.FastRelax: {0} CMD: min  -213.743  14.6695  3.71669  0.55
protocols.relax.FastRelax: {0} MRP: 0  -213.743  -213.743  14.6695  3.71669
protocols.relax.FastRelax: {0} CMD: accept_to_best  -213.743  14.6695  3.71669  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -213.743  14.6695  3.71669  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -213.743  14.6695  3.71669  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -273.315  14.6695  3.71669  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2730 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -285.044  14.6695  3.71669  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -282.173  14.6695  3.71669  0.02805
protocols.relax.FastRelax: {0} CMD: min  -319.946  14.4872  4.28313  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -319.946  14.4872  4.28313  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -225.271  14.4872  4.28313  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2686 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -243.869  14.4872  4.28313  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -239.407  14.4872  4.28313  0.154
protocols.relax.FastRelax: {0} CMD: min  -270.382  14.5082  4.14137  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -270.382  14.5082  4.14137  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -233.337  14.5082  4.14137  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2538 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -233.704  14.5082  4.14137  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -230.785  14.5082  4.14137  0.31955
protocols.relax.FastRelax: {0} CMD: min  -239.15  14.5758  3.99046  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -239.15  14.5758  3.99046  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -200.196  14.5758  3.99046  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2491 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -200.295  14.5758  3.99046  0.55
protocols.relax.FastRelax: {0} CMD: min  -225.953  14.6104  3.99001  0.55
protocols.relax.FastRelax: {0} MRP: 1  -225.953  -225.953  14.6104  3.99001
protocols.relax.FastRelax: {0} CMD: accept_to_best  -225.953  14.6104  3.99001  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -225.953  14.6104  3.99001  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -225.953  14.6104  3.99001  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -287.357  14.6104  3.99001  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2890 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -299.547  14.6104  3.99001  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -296.858  14.6104  3.99001  0.02805
protocols.relax.FastRelax: {0} CMD: min  -346.892  14.2036  4.68837  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -346.892  14.2036  4.68837  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -234.64  14.2036  4.68837  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2902 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -253.877  14.2036  4.68837  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -248.886  14.2036  4.68837  0.154
protocols.relax.FastRelax: {0} CMD: min  -285.49  14.4561  4.1405  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -285.49  14.4561  4.1405  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -245.584  14.4561  4.1405  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2749 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -246.27  14.4561  4.1405  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -243.157  14.4561  4.1405  0.31955
protocols.relax.FastRelax: {0} CMD: min  -249.525  14.5828  3.94805  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -249.525  14.5828  3.94805  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -205.388  14.5828  3.94805  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2657 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -206.396  14.5828  3.94805  0.55
protocols.relax.FastRelax: {0} CMD: min  -239.747  14.7978  3.44355  0.55
protocols.relax.FastRelax: {0} MRP: 2  -239.747  -239.747  14.7978  3.44355
protocols.relax.FastRelax: {0} CMD: accept_to_best  -239.747  14.7978  3.44355  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -239.747  14.7978  3.44355  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -239.747  14.7978  3.44355  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -305.777  14.7978  3.44355  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3230 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -313.757  14.7978  3.44355  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -311.035  14.7978  3.44355  0.02805
protocols.relax.FastRelax: {0} CMD: min  -351.777  14.2527  4.06874  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -351.777  14.2527  4.06874  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -219.767  14.2527  4.06874  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2978 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -252.542  14.2527  4.06874  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -246.06  14.2527  4.06874  0.154
protocols.relax.FastRelax: {0} CMD: min  -301.113  14.5231  3.7261  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -301.113  14.5231  3.7261  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -259.319  14.5231  3.7261  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2810 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -259.713  14.5231  3.7261  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -256.433  14.5231  3.7261  0.31955
protocols.relax.FastRelax: {0} CMD: min  -266.99  14.6546  3.5677  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -266.99  14.6546  3.5677  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -224.202  14.6546  3.5677  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2745 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -222.658  14.6546  3.5677  0.55
protocols.relax.FastRelax: {0} CMD: min  -240.562  14.803  3.38821  0.55
protocols.relax.FastRelax: {0} MRP: 3  -240.562  -240.562  14.803  3.38821
protocols.relax.FastRelax: {0} CMD: accept_to_best  -240.562  14.803  3.38821  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -240.562  14.803  3.38821  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -240.562  14.803  3.38821  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -306.508  14.803  3.38821  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3083 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -315.352  14.803  3.38821  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -313.109  14.803  3.38821  0.02805
protocols.relax.FastRelax: {0} CMD: min  -342.463  14.5428  3.71308  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -342.463  14.5428  3.71308  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -237.183  14.5428  3.71308  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2883 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -265.5  14.5428  3.71308  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -260.854  14.5428  3.71308  0.154
protocols.relax.FastRelax: {0} CMD: min  -297.147  14.5778  3.61414  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -297.147  14.5778  3.61414  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -258.856  14.5778  3.61414  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2756 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -259.388  14.5778  3.61414  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -256.409  14.5778  3.61414  0.31955
protocols.relax.FastRelax: {0} CMD: min  -263.574  14.7075  3.45883  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -263.574  14.7075  3.45883  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -221.942  14.7075  3.45883  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2682 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -222.836  14.7075  3.45883  0.55
protocols.relax.FastRelax: {0} CMD: min  -238.449  14.8183  3.36652  0.55
protocols.relax.FastRelax: {0} MRP: 4  -238.449  -240.562  14.803  3.38821
protocols.relax.FastRelax: {0} CMD: accept_to_best  -238.449  14.8183  3.36652  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -238.449  14.8183  3.36652  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_2.pdb
protocols.relax.FastRelax: {0} CMD: repeat  74567.7  16.0616  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  74567.7  16.0616  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7557.05  16.0616  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3904 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  129.222  16.0616  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  177.214  16.0616  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -236.118  15.1009  3.08483  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -236.118  15.1009  3.08483  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -31.0555  15.1009  3.08483  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3408 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -133.951  15.1009  3.08483  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -124.923  15.1009  3.08483  0.154
protocols.relax.FastRelax: {0} CMD: min  -245.556  15.5964  3.39795  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -245.556  15.5964  3.39795  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -196.809  15.5964  3.39795  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3102 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -199.069  15.5964  3.39795  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -195.274  15.5964  3.39795  0.31955
protocols.relax.FastRelax: {0} CMD: min  -204.962  15.6551  3.6498  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -204.962  15.6551  3.6498  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -153.15  15.6551  3.6498  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2801 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -153.447  15.6551  3.6498  0.55
protocols.relax.FastRelax: {0} CMD: min  -212.774  15.8301  4.062  0.55
protocols.relax.FastRelax: {0} MRP: 0  -212.774  -212.774  15.8301  4.062
protocols.relax.FastRelax: {0} CMD: accept_to_best  -212.774  15.8301  4.062  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -212.774  15.8301  4.062  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -212.774  15.8301  4.062  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -280.544  15.8301  4.062  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3334 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -290.55  15.8301  4.062  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -287.717  15.8301  4.062  0.02805
protocols.relax.FastRelax: {0} CMD: min  -353.188  15.6347  3.86356  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -353.188  15.6347  3.86356  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -177.777  15.6347  3.86356  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3481 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -207.347  15.6347  3.86356  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -198.469  15.6347  3.86356  0.154
protocols.relax.FastRelax: {0} CMD: min  -273.665  15.6982  3.94251  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -273.665  15.6982  3.94251  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -223.023  15.6982  3.94251  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3341 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -224.467  15.6982  3.94251  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -220.526  15.6982  3.94251  0.31955
protocols.relax.FastRelax: {0} CMD: min  -239.64  15.7937  4.02691  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -239.64  15.7937  4.02691  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -195.951  15.7937  4.02691  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3172 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -195.317  15.7937  4.02691  0.55
protocols.relax.FastRelax: {0} CMD: min  -221.733  15.894  4.14942  0.55
protocols.relax.FastRelax: {0} MRP: 1  -221.733  -221.733  15.894  4.14942
protocols.relax.FastRelax: {0} CMD: accept_to_best  -221.733  15.894  4.14942  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -221.733  15.894  4.14942  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -221.733  15.894  4.14942  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -288.773  15.894  4.14942  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3500 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -304.187  15.894  4.14942  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -300.127  15.894  4.14942  0.02805
protocols.relax.FastRelax: {0} CMD: min  -343.352  15.7662  4.00755  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -343.352  15.7662  4.00755  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -171.234  15.7662  4.00755  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3485 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -220.802  15.7662  4.00755  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -213.421  15.7662  4.00755  0.154
protocols.relax.FastRelax: {0} CMD: min  -280.224  15.7306  4.06473  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -280.224  15.7306  4.06473  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -234.094  15.7306  4.06473  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3170 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -235.403  15.7306  4.06473  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -231.891  15.7306  4.06473  0.31955
protocols.relax.FastRelax: {0} CMD: min  -246.364  15.824  4.09419  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -246.364  15.824  4.09419  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -203.468  15.824  4.09419  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2974 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -203.835  15.824  4.09419  0.55
protocols.relax.FastRelax: {0} CMD: min  -222.705  15.8744  4.19679  0.55
protocols.relax.FastRelax: {0} MRP: 2  -222.705  -222.705  15.8744  4.19679
protocols.relax.FastRelax: {0} CMD: accept_to_best  -222.705  15.8744  4.19679  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -222.705  15.8744  4.19679  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -222.705  15.8744  4.19679  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -288.189  15.8744  4.19679  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3493 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -306.232  15.8744  4.19679  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -301.892  15.8744  4.19679  0.02805
protocols.relax.FastRelax: {0} CMD: min  -370.015  15.6607  4.11511  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -370.015  15.6607  4.11511  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -186.761  15.6607  4.11511  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3397 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -215.971  15.6607  4.11511  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -207.191  15.6607  4.11511  0.154
protocols.relax.FastRelax: {0} CMD: min  -279.987  15.7432  4.13991  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -279.987  15.7432  4.13991  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -228.697  15.7432  4.13991  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3146 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -229.908  15.7432  4.13991  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -225.96  15.7432  4.13991  0.31955
protocols.relax.FastRelax: {0} CMD: min  -245.742  15.8469  4.2592  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -245.742  15.8469  4.2592  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -200.295  15.8469  4.2592  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3114 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -199.581  15.8469  4.2592  0.55
protocols.relax.FastRelax: {0} CMD: min  -225.366  15.9475  4.10832  0.55
protocols.relax.FastRelax: {0} MRP: 3  -225.366  -225.366  15.9475  4.10832
protocols.relax.FastRelax: {0} CMD: accept_to_best  -225.366  15.9475  4.10832  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -225.366  15.9475  4.10832  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -225.366  15.9475  4.10832  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -291.826  15.9475  4.10832  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3702 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -302.727  15.9475  4.10832  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -299.278  15.9475  4.10832  0.02805
protocols.relax.FastRelax: {0} CMD: min  -359.681  15.814  4.12383  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -359.681  15.814  4.12383  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -209.012  15.814  4.12383  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3448 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -233.169  15.814  4.12383  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -225.306  15.814  4.12383  0.154
protocols.relax.FastRelax: {0} CMD: min  -288.889  15.8721  3.99651  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -288.889  15.8721  3.99651  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -240.801  15.8721  3.99651  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3218 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -243.084  15.8721  3.99651  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -239.391  15.8721  3.99651  0.31955
protocols.relax.FastRelax: {0} CMD: min  -254.519  15.9579  4.05808  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -254.519  15.9579  4.05808  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -211.699  15.9579  4.05808  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3184 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -211.817  15.9579  4.05808  0.55
protocols.relax.FastRelax: {0} CMD: min  -228.841  15.9616  4.12531  0.55
protocols.relax.FastRelax: {0} MRP: 4  -228.841  -228.841  15.9616  4.12531
protocols.relax.FastRelax: {0} CMD: accept_to_best  -228.841  15.9616  4.12531  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -228.841  15.9616  4.12531  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_23.pdb
protocols.relax.FastRelax: {0} CMD: repeat  69447  18.7197  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  69447  18.7197  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7493.61  18.7197  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3359 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  132.403  18.7197  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  159.302  18.7197  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -228.25  17.9909  3.42173  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -228.25  17.9909  3.42173  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -86.124  17.9909  3.42173  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3045 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -127.406  17.9909  3.42173  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -120.968  17.9909  3.42173  0.154
protocols.relax.FastRelax: {0} CMD: min  -210.364  17.659  3.79674  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -210.364  17.659  3.79674  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -170.201  17.659  3.79674  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3119 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -171.494  17.659  3.79674  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -168.514  17.659  3.79674  0.31955
protocols.relax.FastRelax: {0} CMD: min  -183.191  17.7992  3.77272  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -183.191  17.7992  3.77272  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -147.31  17.7992  3.77272  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2899 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -147.643  17.7992  3.77272  0.55
protocols.relax.FastRelax: {0} CMD: min  -187.125  18.1122  5.26518  0.55
protocols.relax.FastRelax: {0} MRP: 0  -187.125  -187.125  18.1122  5.26518
protocols.relax.FastRelax: {0} CMD: accept_to_best  -187.125  18.1122  5.26518  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -187.125  18.1122  5.26518  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -187.125  18.1122  5.26518  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -245.475  18.1122  5.26518  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2971 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -254.287  18.1122  5.26518  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -252.701  18.1122  5.26518  0.02805
protocols.relax.FastRelax: {0} CMD: min  -307.442  17.6189  5.45553  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -307.442  17.6189  5.45553  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -191.033  17.6189  5.45553  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3261 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -205.337  17.6189  5.45553  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -198.998  17.6189  5.45553  0.154
protocols.relax.FastRelax: {0} CMD: min  -242.207  17.8136  5.41023  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -242.207  17.8136  5.41023  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -194.744  17.8136  5.41023  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3112 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -196.486  17.8136  5.41023  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -192.856  17.8136  5.41023  0.31955
protocols.relax.FastRelax: {0} CMD: min  -212.029  17.8695  5.51841  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -212.029  17.8695  5.51841  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -171.225  17.8695  5.51841  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2784 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -172.232  17.8695  5.51841  0.55
protocols.relax.FastRelax: {0} CMD: min  -195.068  18.1418  5.65324  0.55
protocols.relax.FastRelax: {0} MRP: 1  -195.068  -195.068  18.1418  5.65324
protocols.relax.FastRelax: {0} CMD: accept_to_best  -195.068  18.1418  5.65324  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -195.068  18.1418  5.65324  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -195.068  18.1418  5.65324  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -257.874  18.1418  5.65324  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3198 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -269.127  18.1418  5.65324  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -266.726  18.1418  5.65324  0.02805
protocols.relax.FastRelax: {0} CMD: min  -317.4  17.7951  5.61368  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -317.4  17.7951  5.61368  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -198.131  17.7951  5.61368  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3310 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -219.045  17.7951  5.61368  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -212.963  17.7951  5.61368  0.154
protocols.relax.FastRelax: {0} CMD: min  -258.752  17.8616  5.43116  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -258.752  17.8616  5.43116  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -217.222  17.8616  5.43116  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3056 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -217.366  17.8616  5.43116  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -214.09  17.8616  5.43116  0.31955
protocols.relax.FastRelax: {0} CMD: min  -225  17.9397  5.35874  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -225  17.9397  5.35874  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -182.512  17.9397  5.35874  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2948 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -182.703  17.9397  5.35874  0.55
protocols.relax.FastRelax: {0} CMD: min  -201.891  18.0315  5.23919  0.55
protocols.relax.FastRelax: {0} MRP: 2  -201.891  -201.891  18.0315  5.23919
protocols.relax.FastRelax: {0} CMD: accept_to_best  -201.891  18.0315  5.23919  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -201.891  18.0315  5.23919  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -201.891  18.0315  5.23919  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -264.202  18.0315  5.23919  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3424 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -270.018  18.0315  5.23919  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -268.653  18.0315  5.23919  0.02805
protocols.relax.FastRelax: {0} CMD: min  -309.803  17.5899  4.77154  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -309.803  17.5899  4.77154  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -207.733  17.5899  4.77154  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3404 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -226.199  17.5899  4.77154  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -220.779  17.5899  4.77154  0.154
protocols.relax.FastRelax: {0} CMD: min  -260.629  17.6755  4.87147  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -260.629  17.6755  4.87147  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -220.946  17.6755  4.87147  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3172 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -221.194  17.6755  4.87147  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -218.073  17.6755  4.87147  0.31955
protocols.relax.FastRelax: {0} CMD: min  -224.515  17.7811  5.02925  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -224.515  17.7811  5.02925  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -182.456  17.7811  5.02925  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2929 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -182.531  17.7811  5.02925  0.55
protocols.relax.FastRelax: {0} CMD: min  -202.448  17.9113  4.78955  0.55
protocols.relax.FastRelax: {0} MRP: 3  -202.448  -202.448  17.9113  4.78955
protocols.relax.FastRelax: {0} CMD: accept_to_best  -202.448  17.9113  4.78955  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -202.448  17.9113  4.78955  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -202.448  17.9113  4.78955  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -265.196  17.9113  4.78955  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3288 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -272.941  17.9113  4.78955  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -271.692  17.9113  4.78955  0.02805
protocols.relax.FastRelax: {0} CMD: min  -327.077  17.3517  4.45054  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -327.077  17.3517  4.45054  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -209.957  17.3517  4.45054  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3345 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -223.624  17.3517  4.45054  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -216.905  17.3517  4.45054  0.154
protocols.relax.FastRelax: {0} CMD: min  -267.864  17.5206  4.50771  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -267.864  17.5206  4.50771  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -224.813  17.5206  4.50771  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3128 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -223.322  17.5206  4.50771  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -219.916  17.5206  4.50771  0.31955
protocols.relax.FastRelax: {0} CMD: min  -231.13  17.623  4.60854  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -231.13  17.623  4.60854  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -189.602  17.623  4.60854  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3027 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -189.095  17.623  4.60854  0.55
protocols.relax.FastRelax: {0} CMD: min  -204.624  17.6302  4.2574  0.55
protocols.relax.FastRelax: {0} MRP: 4  -204.624  -204.624  17.6302  4.2574
protocols.relax.FastRelax: {0} CMD: accept_to_best  -204.624  17.6302  4.2574  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -204.624  17.6302  4.2574  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_15.pdb
protocols.relax.FastRelax: {0} CMD: repeat  70507  15.2084  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  70507  15.2084  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7075.62  15.2084  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2542 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -102.238  15.2084  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -74.5782  15.2084  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -298.23  14.5921  2.62802  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -298.23  14.5921  2.62802  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -149.145  14.5921  2.62802  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2773 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -186.971  14.5921  2.62802  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -180.273  14.5921  2.62802  0.154
protocols.relax.FastRelax: {0} CMD: min  -258.839  14.4491  2.86837  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -258.839  14.4491  2.86837  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -213.204  14.4491  2.86837  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2548 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -215.706  14.4491  2.86837  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -212.147  14.4491  2.86837  0.31955
protocols.relax.FastRelax: {0} CMD: min  -222.633  14.5837  2.70261  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -222.633  14.5837  2.70261  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -175.077  14.5837  2.70261  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2454 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -175.544  14.5837  2.70261  0.55
protocols.relax.FastRelax: {0} CMD: min  -212.442  14.0828  2.73448  0.55
protocols.relax.FastRelax: {0} MRP: 0  -212.442  -212.442  14.0828  2.73448
protocols.relax.FastRelax: {0} CMD: accept_to_best  -212.442  14.0828  2.73448  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -212.442  14.0828  2.73448  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -212.442  14.0828  2.73448  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -280.844  14.0828  2.73448  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2367 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -295.282  14.0828  2.73448  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -292.217  14.0828  2.73448  0.02805
protocols.relax.FastRelax: {0} CMD: min  -341.14  13.7027  3.37931  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -341.14  13.7027  3.37931  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -218.151  13.7027  3.37931  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2795 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -235.461  13.7027  3.37931  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -228.758  13.7027  3.37931  0.154
protocols.relax.FastRelax: {0} CMD: min  -280.423  13.7855  3.05636  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -280.423  13.7855  3.05636  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -238.594  13.7855  3.05636  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2554 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -238.831  13.7855  3.05636  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -235.54  13.7855  3.05636  0.31955
protocols.relax.FastRelax: {0} CMD: min  -243.125  14.007  2.88718  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -243.125  14.007  2.88718  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -198.713  14.007  2.88718  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2505 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -199.259  14.007  2.88718  0.55
protocols.relax.FastRelax: {0} CMD: min  -225.981  13.8097  3.0697  0.55
protocols.relax.FastRelax: {0} MRP: 1  -225.981  -225.981  13.8097  3.0697
protocols.relax.FastRelax: {0} CMD: accept_to_best  -225.981  13.8097  3.0697  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -225.981  13.8097  3.0697  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -225.981  13.8097  3.0697  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -293.489  13.8097  3.0697  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2466 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -307.037  13.8097  3.0697  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -303.044  13.8097  3.0697  0.02805
protocols.relax.FastRelax: {0} CMD: min  -358.843  13.3201  3.59608  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -358.843  13.3201  3.59608  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -210.781  13.3201  3.59608  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3004 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -236.478  13.3201  3.59608  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -228.895  13.3201  3.59608  0.154
protocols.relax.FastRelax: {0} CMD: min  -288.792  13.6392  3.27869  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -288.792  13.6392  3.27869  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -242.817  13.6392  3.27869  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2401 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -243.793  13.6392  3.27869  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -240.191  13.6392  3.27869  0.31955
protocols.relax.FastRelax: {0} CMD: min  -252.231  13.7005  3.19648  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -252.231  13.7005  3.19648  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -203.816  13.7005  3.19648  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2311 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -205.334  13.7005  3.19648  0.55
protocols.relax.FastRelax: {0} CMD: min  -229.557  13.8062  3.1656  0.55
protocols.relax.FastRelax: {0} MRP: 2  -229.557  -229.557  13.8062  3.1656
protocols.relax.FastRelax: {0} CMD: accept_to_best  -229.557  13.8062  3.1656  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -229.557  13.8062  3.1656  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -229.557  13.8062  3.1656  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -298.134  13.8062  3.1656  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2489 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -309.673  13.8062  3.1656  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -306.7  13.8062  3.1656  0.02805
protocols.relax.FastRelax: {0} CMD: min  -359.948  13.2365  3.85471  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -359.948  13.2365  3.85471  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -225.784  13.2365  3.85471  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2876 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -248.289  13.2365  3.85471  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -241.395  13.2365  3.85471  0.154
protocols.relax.FastRelax: {0} CMD: min  -296.163  13.3759  3.74199  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -296.163  13.3759  3.74199  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -252.526  13.3759  3.74199  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2272 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -253.055  13.3759  3.74199  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -249.663  13.3759  3.74199  0.31955
protocols.relax.FastRelax: {0} CMD: min  -266.498  13.3194  3.73963  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -266.498  13.3194  3.73963  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -224.36  13.3194  3.73963  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2246 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -224.397  13.3194  3.73963  0.55
protocols.relax.FastRelax: {0} CMD: min  -238.953  13.2339  3.71761  0.55
protocols.relax.FastRelax: {0} MRP: 3  -238.953  -238.953  13.2339  3.71761
protocols.relax.FastRelax: {0} CMD: accept_to_best  -238.953  13.2339  3.71761  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -238.953  13.2339  3.71761  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -238.953  13.2339  3.71761  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -306.392  13.2339  3.71761  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2494 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -317.377  13.2339  3.71761  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -315.106  13.2339  3.71761  0.02805
protocols.relax.FastRelax: {0} CMD: min  -354.958  13.0257  4.03267  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -354.958  13.0257  4.03267  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -240.799  13.0257  4.03267  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2878 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -265.661  13.0257  4.03267  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -260.156  13.0257  4.03267  0.154
protocols.relax.FastRelax: {0} CMD: min  -302.195  13.2971  3.84825  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -302.195  13.2971  3.84825  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -260.555  13.2971  3.84825  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2425 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -261.043  13.2971  3.84825  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -257.805  13.2971  3.84825  0.31955
protocols.relax.FastRelax: {0} CMD: min  -267.114  13.3849  3.72487  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -267.114  13.3849  3.72487  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -224.687  13.3849  3.72487  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2200 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -224.841  13.3849  3.72487  0.55
protocols.relax.FastRelax: {0} CMD: min  -240.814  13.4734  3.6373  0.55
protocols.relax.FastRelax: {0} MRP: 4  -240.814  -240.814  13.4734  3.6373
protocols.relax.FastRelax: {0} CMD: accept_to_best  -240.814  13.4734  3.6373  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -240.814  13.4734  3.6373  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_45.pdb
protocols.relax.FastRelax: {0} CMD: repeat  73102.7  15.5842  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  73102.7  15.5842  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  8478.37  15.5842  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3373 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  235.079  15.5842  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  294.124  15.5842  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -19.0453  15.0859  9.60688  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -19.0453  15.0859  9.60688  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  864.262  15.0859  9.60688  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2800 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -40.721  15.0859  9.60688  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -30.0109  15.0859  9.60688  0.154
protocols.relax.FastRelax: {0} CMD: min  -212.821  14.424  10.6988  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -212.821  14.424  10.6988  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -173.985  14.424  10.6988  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2685 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -184.961  14.424  10.6988  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -182.012  14.424  10.6988  0.31955
protocols.relax.FastRelax: {0} CMD: min  -194.444  14.4105  10.7468  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -194.444  14.4105  10.7468  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -155.663  14.4105  10.7468  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2655 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -157.136  14.4105  10.7468  0.55
protocols.relax.FastRelax: {0} CMD: min  -206.733  14.8606  10.7103  0.55
protocols.relax.FastRelax: {0} MRP: 0  -206.733  -206.733  14.8606  10.7103
protocols.relax.FastRelax: {0} CMD: accept_to_best  -206.733  14.8606  10.7103  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -206.733  14.8606  10.7103  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -206.733  14.8606  10.7103  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -264.013  14.8606  10.7103  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2950 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -280.311  14.8606  10.7103  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -278.168  14.8606  10.7103  0.02805
protocols.relax.FastRelax: {0} CMD: min  -316.838  14.6159  10.7223  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -316.838  14.6159  10.7223  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -188.702  14.6159  10.7223  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2874 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -218.502  14.6159  10.7223  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -212.208  14.6159  10.7223  0.154
protocols.relax.FastRelax: {0} CMD: min  -269.883  14.6931  10.7465  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -269.883  14.6931  10.7465  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -233.404  14.6931  10.7465  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2803 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -233.809  14.6931  10.7465  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -230.972  14.6931  10.7465  0.31955
protocols.relax.FastRelax: {0} CMD: min  -239.686  14.7295  10.7941  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -239.686  14.7295  10.7941  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -203.647  14.7295  10.7941  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2725 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -204.853  14.7295  10.7941  0.55
protocols.relax.FastRelax: {0} CMD: min  -226.984  14.8857  10.8758  0.55
protocols.relax.FastRelax: {0} MRP: 1  -226.984  -226.984  14.8857  10.8758
protocols.relax.FastRelax: {0} CMD: accept_to_best  -226.984  14.8857  10.8758  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -226.984  14.8857  10.8758  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -226.984  14.8857  10.8758  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -284.222  14.8857  10.8758  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2925 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -291.32  14.8857  10.8758  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -289.581  14.8857  10.8758  0.02805
protocols.relax.FastRelax: {0} CMD: min  -328.805  14.7741  10.7099  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -328.805  14.7741  10.7099  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -235.571  14.7741  10.7099  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2935 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -247.131  14.7741  10.7099  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -242.618  14.7741  10.7099  0.154
protocols.relax.FastRelax: {0} CMD: min  -273.328  14.7467  10.8366  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -273.328  14.7467  10.8366  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -237.412  14.7467  10.8366  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2717 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -237.913  14.7467  10.8366  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -235.173  14.7467  10.8366  0.31955
protocols.relax.FastRelax: {0} CMD: min  -243.353  14.7671  10.8988  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -243.353  14.7671  10.8988  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -206.334  14.7671  10.8988  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2712 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -206.697  14.7671  10.8988  0.55
protocols.relax.FastRelax: {0} CMD: min  -229.224  14.5314  11.1048  0.55
protocols.relax.FastRelax: {0} MRP: 2  -229.224  -229.224  14.5314  11.1048
protocols.relax.FastRelax: {0} CMD: accept_to_best  -229.224  14.5314  11.1048  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -229.224  14.5314  11.1048  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -229.224  14.5314  11.1048  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -287.634  14.5314  11.1048  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3069 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -294.709  14.5314  11.1048  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -292.416  14.5314  11.1048  0.02805
protocols.relax.FastRelax: {0} CMD: min  -337.791  14.3945  11.0547  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -337.791  14.3945  11.0547  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -229.752  14.3945  11.0547  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3034 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -240.6  14.3945  11.0547  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -234.548  14.3945  11.0547  0.154
protocols.relax.FastRelax: {0} CMD: min  -281.599  14.3865  11.1218  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -281.599  14.3865  11.1218  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -242.706  14.3865  11.1218  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2852 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -243.848  14.3865  11.1218  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -240.891  14.3865  11.1218  0.31955
protocols.relax.FastRelax: {0} CMD: min  -250.116  14.4308  11.1156  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -250.116  14.4308  11.1156  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -210.986  14.4308  11.1156  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2821 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -210.698  14.4308  11.1156  0.55
protocols.relax.FastRelax: {0} CMD: min  -229.515  14.5114  11.1073  0.55
protocols.relax.FastRelax: {0} MRP: 3  -229.515  -229.515  14.5114  11.1073
protocols.relax.FastRelax: {0} CMD: accept_to_best  -229.515  14.5114  11.1073  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -229.515  14.5114  11.1073  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -229.515  14.5114  11.1073  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -288.221  14.5114  11.1073  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3132 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -295.451  14.5114  11.1073  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -292.745  14.5114  11.1073  0.02805
protocols.relax.FastRelax: {0} CMD: min  -337.634  14.4101  11.0437  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -337.634  14.4101  11.0437  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -214.86  14.4101  11.0437  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3020 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -228.37  14.4101  11.0437  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -221.771  14.4101  11.0437  0.154
protocols.relax.FastRelax: {0} CMD: min  -277.329  14.512  11.0366  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -277.329  14.512  11.0366  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -237.431  14.512  11.0366  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2829 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -239.114  14.512  11.0366  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -235.919  14.512  11.0366  0.31955
protocols.relax.FastRelax: {0} CMD: min  -248.892  14.3785  11.0944  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -248.892  14.3785  11.0944  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -209.448  14.3785  11.0944  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2807 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -211.702  14.3785  11.0944  0.55
protocols.relax.FastRelax: {0} CMD: min  -230.346  14.4933  11.1005  0.55
protocols.relax.FastRelax: {0} MRP: 4  -230.346  -230.346  14.4933  11.1005
protocols.relax.FastRelax: {0} CMD: accept_to_best  -230.346  14.4933  11.1005  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -230.346  14.4933  11.1005  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_25.pdb
protocols.relax.FastRelax: {0} CMD: repeat  69282  14.5283  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  69282  14.5283  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7524.44  14.5283  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2915 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  140.599  14.5283  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  175.46  14.5283  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -263.337  14.4279  1.67245  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -263.337  14.4279  1.67245  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -87.9394  14.4279  1.67245  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2896 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -111.855  14.4279  1.67245  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -101.722  14.4279  1.67245  0.154
protocols.relax.FastRelax: {0} CMD: min  -212.381  14.647  2.17647  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -212.381  14.647  2.17647  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -160.058  14.647  2.17647  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2454 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -161.482  14.647  2.17647  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -157.312  14.647  2.17647  0.31955
protocols.relax.FastRelax: {0} CMD: min  -172.781  14.6917  2.24533  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -172.781  14.6917  2.24533  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -120.424  14.6917  2.24533  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2423 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -121.212  14.6917  2.24533  0.55
protocols.relax.FastRelax: {0} CMD: min  -172.565  14.9952  3.18887  0.55
protocols.relax.FastRelax: {0} MRP: 0  -172.565  -172.565  14.9952  3.18887
protocols.relax.FastRelax: {0} CMD: accept_to_best  -172.565  14.9952  3.18887  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -172.565  14.9952  3.18887  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -172.565  14.9952  3.18887  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -243.134  14.9952  3.18887  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2836 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -255.274  14.9952  3.18887  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -253.142  14.9952  3.18887  0.02805
protocols.relax.FastRelax: {0} CMD: min  -330.112  14.7998  3.35633  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -330.112  14.7998  3.35633  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -172.241  14.7998  3.35633  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2878 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -183.005  14.7998  3.35633  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -173.108  14.7998  3.35633  0.154
protocols.relax.FastRelax: {0} CMD: min  -262.339  14.869  3.31507  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -262.339  14.869  3.31507  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -212.595  14.869  3.31507  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2667 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -212.806  14.869  3.31507  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -208.977  14.869  3.31507  0.31955
protocols.relax.FastRelax: {0} CMD: min  -220.696  14.9589  3.44632  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -220.696  14.9589  3.44632  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -170.848  14.9589  3.44632  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2549 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -170.958  14.9589  3.44632  0.55
protocols.relax.FastRelax: {0} CMD: min  -194.693  15.1221  3.72795  0.55
protocols.relax.FastRelax: {0} MRP: 1  -194.693  -194.693  15.1221  3.72795
protocols.relax.FastRelax: {0} CMD: accept_to_best  -194.693  15.1221  3.72795  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -194.693  15.1221  3.72795  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -194.693  15.1221  3.72795  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -266.526  15.1221  3.72795  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2830 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -274.463  15.1221  3.72795  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -272.849  15.1221  3.72795  0.02805
protocols.relax.FastRelax: {0} CMD: min  -324.104  14.9473  3.72974  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -324.104  14.9473  3.72974  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -191.077  14.9473  3.72974  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2721 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -200.234  14.9473  3.72974  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -192.795  14.9473  3.72974  0.154
protocols.relax.FastRelax: {0} CMD: min  -253.194  14.9577  3.52757  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -253.194  14.9577  3.52757  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -206.141  14.9577  3.52757  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2612 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -206.878  14.9577  3.52757  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -203.165  14.9577  3.52757  0.31955
protocols.relax.FastRelax: {0} CMD: min  -221.061  14.8991  3.2732  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -221.061  14.8991  3.2732  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -177.851  14.8991  3.2732  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2548 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -177.86  14.8991  3.2732  0.55
protocols.relax.FastRelax: {0} CMD: min  -200.093  14.6786  3.11995  0.55
protocols.relax.FastRelax: {0} MRP: 2  -200.093  -200.093  14.6786  3.11995
protocols.relax.FastRelax: {0} CMD: accept_to_best  -200.093  14.6786  3.11995  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -200.093  14.6786  3.11995  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -200.093  14.6786  3.11995  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -272.331  14.6786  3.11995  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2967 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -279.17  14.6786  3.11995  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -277.418  14.6786  3.11995  0.02805
protocols.relax.FastRelax: {0} CMD: min  -329.582  14.5737  3.23293  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -329.582  14.5737  3.23293  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -191.953  14.5737  3.23293  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2952 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -205.308  14.5737  3.23293  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -196.877  14.5737  3.23293  0.154
protocols.relax.FastRelax: {0} CMD: min  -268.065  14.6491  3.218  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -268.065  14.6491  3.218  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -219.303  14.6491  3.218  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2609 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -219.323  14.6491  3.218  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -215.508  14.6491  3.218  0.31955
protocols.relax.FastRelax: {0} CMD: min  -229.629  14.6727  3.16322  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -229.629  14.6727  3.16322  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -183.185  14.6727  3.16322  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2565 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -183.537  14.6727  3.16322  0.55
protocols.relax.FastRelax: {0} CMD: min  -201.152  14.6942  3.12632  0.55
protocols.relax.FastRelax: {0} MRP: 3  -201.152  -201.152  14.6942  3.12632
protocols.relax.FastRelax: {0} CMD: accept_to_best  -201.152  14.6942  3.12632  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -201.152  14.6942  3.12632  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -201.152  14.6942  3.12632  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -272.287  14.6942  3.12632  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2943 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -278.481  14.6942  3.12632  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -276.766  14.6942  3.12632  0.02805
protocols.relax.FastRelax: {0} CMD: min  -338.712  14.5985  3.34972  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -338.712  14.5985  3.34972  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -196.679  14.5985  3.34972  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2897 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -205.747  14.5985  3.34972  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -196.84  14.5985  3.34972  0.154
protocols.relax.FastRelax: {0} CMD: min  -273.449  14.6209  3.21909  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -273.449  14.6209  3.21909  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -224.072  14.6209  3.21909  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2596 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -225.071  14.6209  3.21909  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -221.191  14.6209  3.21909  0.31955
protocols.relax.FastRelax: {0} CMD: min  -233.82  14.6473  3.2009  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -233.82  14.6473  3.2009  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -186.036  14.6473  3.2009  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2581 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -186.386  14.6473  3.2009  0.55
protocols.relax.FastRelax: {0} CMD: min  -207.671  14.6477  3.37923  0.55
protocols.relax.FastRelax: {0} MRP: 4  -207.671  -207.671  14.6477  3.37923
protocols.relax.FastRelax: {0} CMD: accept_to_best  -207.671  14.6477  3.37923  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -207.671  14.6477  3.37923  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_36.pdb
protocols.relax.FastRelax: {0} CMD: repeat  71851.5  16.3127  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  71851.5  16.3127  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7893.19  16.3127  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2334 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -77.624  16.3127  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -46.7938  16.3127  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -267.009  15.7255  3.83147  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -267.009  15.7255  3.83147  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -104.314  15.7255  3.83147  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2388 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -136.628  15.7255  3.83147  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -128.697  15.7255  3.83147  0.154
protocols.relax.FastRelax: {0} CMD: min  -205.918  16.1232  3.47239  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -205.918  16.1232  3.47239  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -162.696  16.1232  3.47239  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2259 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -161.912  16.1232  3.47239  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -158.575  16.1232  3.47239  0.31955
protocols.relax.FastRelax: {0} CMD: min  -177.945  16.2019  3.86759  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -177.945  16.2019  3.86759  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -140.708  16.2019  3.86759  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2118 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -140.635  16.2019  3.86759  0.55
protocols.relax.FastRelax: {0} CMD: min  -197.189  16.8224  6.46462  0.55
protocols.relax.FastRelax: {0} MRP: 0  -197.189  -197.189  16.8224  6.46462
protocols.relax.FastRelax: {0} CMD: accept_to_best  -197.189  16.8224  6.46462  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -197.189  16.8224  6.46462  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -197.189  16.8224  6.46462  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -252.415  16.8224  6.46462  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2293 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -263.506  16.8224  6.46462  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -260.704  16.8224  6.46462  0.02805
protocols.relax.FastRelax: {0} CMD: min  -304.519  16.6571  6.52356  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -304.519  16.6571  6.52356  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -173.915  16.6571  6.52356  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2677 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -201.784  16.6571  6.52356  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -196.15  16.6571  6.52356  0.154
protocols.relax.FastRelax: {0} CMD: min  -246.399  16.7125  6.8985  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -246.399  16.7125  6.8985  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -206.253  16.7125  6.8985  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2411 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -207.581  16.7125  6.8985  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -204.508  16.7125  6.8985  0.31955
protocols.relax.FastRelax: {0} CMD: min  -207.399  16.7671  6.91694  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -207.399  16.7671  6.91694  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -158.37  16.7671  6.91694  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2281 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -161.191  16.7671  6.91694  0.55
protocols.relax.FastRelax: {0} CMD: min  -208.835  16.9291  9.1543  0.55
protocols.relax.FastRelax: {0} MRP: 1  -208.835  -208.835  16.9291  9.1543
protocols.relax.FastRelax: {0} CMD: accept_to_best  -208.835  16.9291  9.1543  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -208.835  16.9291  9.1543  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -208.835  16.9291  9.1543  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -267.334  16.9291  9.1543  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2630 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -282.961  16.9291  9.1543  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -279.961  16.9291  9.1543  0.02805
protocols.relax.FastRelax: {0} CMD: min  -333.244  16.4599  8.59069  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -333.244  16.4599  8.59069  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -195.243  16.4599  8.59069  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3059 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -223.261  16.4599  8.59069  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -216.883  16.4599  8.59069  0.154
protocols.relax.FastRelax: {0} CMD: min  -272.965  16.6212  8.81656  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -272.965  16.6212  8.81656  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -229.945  16.6212  8.81656  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2797 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -231.297  16.6212  8.81656  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -227.954  16.6212  8.81656  0.31955
protocols.relax.FastRelax: {0} CMD: min  -235.812  16.7303  8.85094  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -235.812  16.7303  8.85094  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -192.359  16.7303  8.85094  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2729 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -192.681  16.7303  8.85094  0.55
protocols.relax.FastRelax: {0} CMD: min  -223.231  16.8686  8.49248  0.55
protocols.relax.FastRelax: {0} MRP: 2  -223.231  -223.231  16.8686  8.49248
protocols.relax.FastRelax: {0} CMD: accept_to_best  -223.231  16.8686  8.49248  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -223.231  16.8686  8.49248  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -223.231  16.8686  8.49248  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -284.679  16.8686  8.49248  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2821 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -298.341  16.8686  8.49248  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -294.762  16.8686  8.49248  0.02805
protocols.relax.FastRelax: {0} CMD: min  -346.821  16.4424  8.3958  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -346.821  16.4424  8.3958  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -186.991  16.4424  8.3958  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3048 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -214.442  16.4424  8.3958  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -206.651  16.4424  8.3958  0.154
protocols.relax.FastRelax: {0} CMD: min  -280.611  16.6187  8.56528  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -280.611  16.6187  8.56528  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -238.846  16.6187  8.56528  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2902 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -239.973  16.6187  8.56528  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -236.737  16.6187  8.56528  0.31955
protocols.relax.FastRelax: {0} CMD: min  -246.696  16.6956  8.64434  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -246.696  16.6956  8.64434  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -204.909  16.6956  8.64434  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2739 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -205.126  16.6956  8.64434  0.55
protocols.relax.FastRelax: {0} CMD: min  -226.464  16.8421  8.56758  0.55
protocols.relax.FastRelax: {0} MRP: 3  -226.464  -226.464  16.8421  8.56758
protocols.relax.FastRelax: {0} CMD: accept_to_best  -226.464  16.8421  8.56758  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -226.464  16.8421  8.56758  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -226.464  16.8421  8.56758  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -286.991  16.8421  8.56758  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2844 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -297.098  16.8421  8.56758  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -293.621  16.8421  8.56758  0.02805
protocols.relax.FastRelax: {0} CMD: min  -327.004  16.5202  8.37984  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -327.004  16.5202  8.37984  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -173.077  16.5202  8.37984  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3057 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -221.393  16.5202  8.37984  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -214.142  16.5202  8.37984  0.154
protocols.relax.FastRelax: {0} CMD: min  -286.424  16.6569  8.38759  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -286.424  16.6569  8.38759  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -247.153  16.6569  8.38759  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2850 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -247.588  16.6569  8.38759  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -244.501  16.6569  8.38759  0.31955
protocols.relax.FastRelax: {0} CMD: min  -252.912  16.7246  8.45483  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -252.912  16.7246  8.45483  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -212.997  16.7246  8.45483  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2657 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -213.289  16.7246  8.45483  0.55
protocols.relax.FastRelax: {0} CMD: min  -231.258  16.8243  8.56202  0.55
protocols.relax.FastRelax: {0} MRP: 4  -231.258  -231.258  16.8243  8.56202
protocols.relax.FastRelax: {0} CMD: accept_to_best  -231.258  16.8243  8.56202  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -231.258  16.8243  8.56202  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_16.pdb
protocols.relax.FastRelax: {0} CMD: repeat  76963.5  11.7886  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  76963.5  11.7886  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7231.25  11.7886  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3335 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  138.172  11.7886  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  199.844  11.7886  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -292.085  11.85  2.49107  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -292.085  11.85  2.49107  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -122.429  11.85  2.49107  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2890 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -151.838  11.85  2.49107  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -142.737  11.85  2.49107  0.154
protocols.relax.FastRelax: {0} CMD: min  -239.476  11.9542  2.93401  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -239.476  11.9542  2.93401  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -191.831  11.9542  2.93401  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2922 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -193.614  11.9542  2.93401  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -189.947  11.9542  2.93401  0.31955
protocols.relax.FastRelax: {0} CMD: min  -202.775  11.944  2.90839  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -202.775  11.944  2.90839  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -155.794  11.944  2.90839  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2611 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -156.055  11.944  2.90839  0.55
protocols.relax.FastRelax: {0} CMD: min  -206.74  12.0214  3.51623  0.55
protocols.relax.FastRelax: {0} MRP: 0  -206.74  -206.74  12.0214  3.51623
protocols.relax.FastRelax: {0} CMD: accept_to_best  -206.74  12.0214  3.51623  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -206.74  12.0214  3.51623  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -206.74  12.0214  3.51623  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -274.025  12.0214  3.51623  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3459 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -290.065  12.0214  3.51623  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -286.718  12.0214  3.51623  0.02805
protocols.relax.FastRelax: {0} CMD: min  -359.358  12.0262  3.87942  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -359.358  12.0262  3.87942  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -211.938  12.0262  3.87942  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3129 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -223.822  12.0262  3.87942  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -215.775  12.0262  3.87942  0.154
protocols.relax.FastRelax: {0} CMD: min  -280.49  12.0951  3.7877  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -280.49  12.0951  3.7877  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -230.26  12.0951  3.7877  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2964 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -233.443  12.0951  3.7877  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -229.605  12.0951  3.7877  0.31955
protocols.relax.FastRelax: {0} CMD: min  -241.617  12.0334  3.71358  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -241.617  12.0334  3.71358  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -192.257  12.0334  3.71358  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2925 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -192.424  12.0334  3.71358  0.55
protocols.relax.FastRelax: {0} CMD: min  -228.031  11.9944  4.06966  0.55
protocols.relax.FastRelax: {0} MRP: 1  -228.031  -228.031  11.9944  4.06966
protocols.relax.FastRelax: {0} CMD: accept_to_best  -228.031  11.9944  4.06966  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -228.031  11.9944  4.06966  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -228.031  11.9944  4.06966  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -296.735  11.9944  4.06966  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3438 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -313.562  11.9944  4.06966  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -309.081  11.9944  4.06966  0.02805
protocols.relax.FastRelax: {0} CMD: min  -368.808  12.363  4.58173  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -368.808  12.363  4.58173  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -209.487  12.363  4.58173  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3305 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -230.904  12.363  4.58173  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -222.706  12.363  4.58173  0.154
protocols.relax.FastRelax: {0} CMD: min  -295.483  12.1973  4.15402  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -295.483  12.1973  4.15402  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -249.392  12.1973  4.15402  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2970 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -250.472  12.1973  4.15402  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -246.831  12.1973  4.15402  0.31955
protocols.relax.FastRelax: {0} CMD: min  -259.76  12.1462  4.08793  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -259.76  12.1462  4.08793  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -215.204  12.1462  4.08793  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2842 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -215.884  12.1462  4.08793  0.55
protocols.relax.FastRelax: {0} CMD: min  -238.81  12.0759  4.1223  0.55
protocols.relax.FastRelax: {0} MRP: 2  -238.81  -238.81  12.0759  4.1223
protocols.relax.FastRelax: {0} CMD: accept_to_best  -238.81  12.0759  4.1223  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -238.81  12.0759  4.1223  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -238.81  12.0759  4.1223  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -309.368  12.0759  4.1223  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3246 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -325.114  12.0759  4.1223  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -321.134  12.0759  4.1223  0.02805
protocols.relax.FastRelax: {0} CMD: min  -393.527  12.2899  4.60321  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -393.527  12.2899  4.60321  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -223.787  12.2899  4.60321  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3154 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -236.622  12.2899  4.60321  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -227.021  12.2899  4.60321  0.154
protocols.relax.FastRelax: {0} CMD: min  -314.965  12.2895  4.40259  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -314.965  12.2895  4.40259  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -264.411  12.2895  4.40259  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3018 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -264.793  12.2895  4.40259  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -260.839  12.2895  4.40259  0.31955
protocols.relax.FastRelax: {0} CMD: min  -274.578  12.2282  4.25674  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -274.578  12.2282  4.25674  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -227.081  12.2282  4.25674  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2884 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -227.166  12.2282  4.25674  0.55
protocols.relax.FastRelax: {0} CMD: min  -246.238  12.1619  4.05076  0.55
protocols.relax.FastRelax: {0} MRP: 3  -246.238  -246.238  12.1619  4.05076
protocols.relax.FastRelax: {0} CMD: accept_to_best  -246.238  12.1619  4.05076  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -246.238  12.1619  4.05076  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -246.238  12.1619  4.05076  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -317.321  12.1619  4.05076  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3345 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -331.399  12.1619  4.05076  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -328.544  12.1619  4.05076  0.02805
protocols.relax.FastRelax: {0} CMD: min  -386.909  12.2928  4.33194  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -386.909  12.2928  4.33194  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -228.389  12.2928  4.33194  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3231 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -261.878  12.2928  4.33194  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -254.144  12.2928  4.33194  0.154
protocols.relax.FastRelax: {0} CMD: min  -315.756  12.2551  4.10335  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -315.756  12.2551  4.10335  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -267.274  12.2551  4.10335  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2966 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -267.53  12.2551  4.10335  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -263.711  12.2551  4.10335  0.31955
protocols.relax.FastRelax: {0} CMD: min  -277.316  12.2182  4.0069  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -277.316  12.2182  4.0069  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -231.71  12.2182  4.0069  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2879 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -231.729  12.2182  4.0069  0.55
protocols.relax.FastRelax: {0} CMD: min  -247.147  12.0466  3.90345  0.55
protocols.relax.FastRelax: {0} MRP: 4  -247.147  -247.147  12.0466  3.90345
protocols.relax.FastRelax: {0} CMD: accept_to_best  -247.147  12.0466  3.90345  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -247.147  12.0466  3.90345  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_3.pdb
protocols.relax.FastRelax: {0} CMD: repeat  71338.5  13.8809  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  71338.5  13.8809  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7748.63  13.8809  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2499 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -136.683  13.8809  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -122.746  13.8809  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -270.261  14.26  4.2219  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -270.261  14.26  4.2219  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -163.057  14.26  4.2219  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2342 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -181.533  14.26  4.2219  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -175.488  14.26  4.2219  0.154
protocols.relax.FastRelax: {0} CMD: min  -227.15  14.3631  4.06176  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -227.15  14.3631  4.06176  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -183.63  14.3631  4.06176  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2081 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -185.353  14.3631  4.06176  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -182.059  14.3631  4.06176  0.31955
protocols.relax.FastRelax: {0} CMD: min  -195.9  14.4479  3.77299  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -195.9  14.4479  3.77299  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -155.396  14.4479  3.77299  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2005 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -156.015  14.4479  3.77299  0.55
protocols.relax.FastRelax: {0} CMD: min  -210.243  13.9625  4.0121  0.55
protocols.relax.FastRelax: {0} MRP: 0  -210.243  -210.243  13.9625  4.0121
protocols.relax.FastRelax: {0} CMD: accept_to_best  -210.243  13.9625  4.0121  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -210.243  13.9625  4.0121  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -210.243  13.9625  4.0121  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -267.748  13.9625  4.0121  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2177 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -278.914  13.9625  4.0121  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -277.268  13.9625  4.0121  0.02805
protocols.relax.FastRelax: {0} CMD: min  -320.153  13.5713  5.02238  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -320.153  13.5713  5.02238  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -223.988  13.5713  5.02238  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2450 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -235.643  13.5713  5.02238  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -230.141  13.5713  5.02238  0.154
protocols.relax.FastRelax: {0} CMD: min  -271.343  13.7508  4.89322  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -271.343  13.7508  4.89322  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -231.657  13.7508  4.89322  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2156 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -232.682  13.7508  4.89322  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -229.696  13.7508  4.89322  0.31955
protocols.relax.FastRelax: {0} CMD: min  -235.577  13.791  4.85759  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -235.577  13.791  4.85759  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -196.213  13.791  4.85759  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2037 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -196.226  13.791  4.85759  0.55
protocols.relax.FastRelax: {0} CMD: min  -223.895  14.4522  6.07739  0.55
protocols.relax.FastRelax: {0} MRP: 1  -223.895  -223.895  14.4522  6.07739
protocols.relax.FastRelax: {0} CMD: accept_to_best  -223.895  14.4522  6.07739  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -223.895  14.4522  6.07739  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -223.895  14.4522  6.07739  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -283.446  14.4522  6.07739  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2179 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -289.079  14.4522  6.07739  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -287.982  14.4522  6.07739  0.02805
protocols.relax.FastRelax: {0} CMD: min  -321.286  14.1891  5.95018  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -321.286  14.1891  5.95018  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -230.28  14.1891  5.95018  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2373 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -236.812  14.1891  5.95018  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -231.176  14.1891  5.95018  0.154
protocols.relax.FastRelax: {0} CMD: min  -278.843  14.3362  5.88507  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -278.843  14.3362  5.88507  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -243.14  14.3362  5.88507  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2214 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -243.307  14.3362  5.88507  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -240.491  14.3362  5.88507  0.31955
protocols.relax.FastRelax: {0} CMD: min  -244.28  14.325  5.76677  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -244.28  14.325  5.76677  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -203.149  14.325  5.76677  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2001 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -203.326  14.325  5.76677  0.55
protocols.relax.FastRelax: {0} CMD: min  -226.524  14.601  6.21266  0.55
protocols.relax.FastRelax: {0} MRP: 2  -226.524  -226.524  14.601  6.21266
protocols.relax.FastRelax: {0} CMD: accept_to_best  -226.524  14.601  6.21266  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -226.524  14.601  6.21266  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -226.524  14.601  6.21266  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -285.928  14.601  6.21266  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2193 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -290.576  14.601  6.21266  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -289.025  14.601  6.21266  0.02805
protocols.relax.FastRelax: {0} CMD: min  -326.626  14.2368  6.39493  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -326.626  14.2368  6.39493  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -214.051  14.2368  6.39493  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2601 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -230.091  14.2368  6.39493  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -224.095  14.2368  6.39493  0.154
protocols.relax.FastRelax: {0} CMD: min  -274.079  14.4676  6.44888  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -274.079  14.4676  6.44888  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -238.728  14.4676  6.44888  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2270 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -240.885  14.4676  6.44888  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -238.191  14.4676  6.44888  0.31955
protocols.relax.FastRelax: {0} CMD: min  -248.901  14.4527  6.31245  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -248.901  14.4527  6.31245  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -212.74  14.4527  6.31245  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2005 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -212.779  14.4527  6.31245  0.55
protocols.relax.FastRelax: {0} CMD: min  -225.351  14.5577  6.61605  0.55
protocols.relax.FastRelax: {0} MRP: 3  -225.351  -226.524  14.601  6.21266
protocols.relax.FastRelax: {0} CMD: accept_to_best  -225.351  14.5577  6.61605  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -225.351  14.5577  6.61605  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -225.351  14.5577  6.61605  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -284.551  14.5577  6.61605  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2240 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -290.046  14.5577  6.61605  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -288.895  14.5577  6.61605  0.02805
protocols.relax.FastRelax: {0} CMD: min  -329.42  14.0591  6.69667  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -329.42  14.0591  6.69667  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -231.837  14.0591  6.69667  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2847 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -241.031  14.0591  6.69667  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -235.349  14.0591  6.69667  0.154
protocols.relax.FastRelax: {0} CMD: min  -278.289  14.3184  6.54065  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -278.289  14.3184  6.54065  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -239.752  14.3184  6.54065  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2306 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -240.557  14.3184  6.54065  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -237.503  14.3184  6.54065  0.31955
protocols.relax.FastRelax: {0} CMD: min  -247.64  14.3402  6.36644  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -247.64  14.3402  6.36644  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -209.015  14.3402  6.36644  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2203 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -209.693  14.3402  6.36644  0.55
protocols.relax.FastRelax: {0} CMD: min  -225.566  14.5923  6.61051  0.55
protocols.relax.FastRelax: {0} MRP: 4  -225.566  -226.524  14.601  6.21266
protocols.relax.FastRelax: {0} CMD: accept_to_best  -225.566  14.5923  6.61051  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -225.566  14.5923  6.61051  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_24.pdb
protocols.relax.FastRelax: {0} CMD: repeat  70069.4  15.5995  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  70069.4  15.5995  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7096.69  15.5995  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3165 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -78.3106  15.5995  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -38.4692  15.5995  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -260.44  15.8616  2.37027  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -260.44  15.8616  2.37027  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -112.571  15.8616  2.37027  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2872 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -145.758  15.8616  2.37027  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -138.819  15.8616  2.37027  0.154
protocols.relax.FastRelax: {0} CMD: min  -212.667  15.3913  3.60392  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -212.667  15.3913  3.60392  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -168.167  15.3913  3.60392  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2421 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -172.003  15.3913  3.60392  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -168.608  15.3913  3.60392  0.31955
protocols.relax.FastRelax: {0} CMD: min  -180.566  15.5505  3.88661  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -180.566  15.5505  3.88661  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -138.981  15.5505  3.88661  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2361 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -140.243  15.5505  3.88661  0.55
protocols.relax.FastRelax: {0} CMD: min  -188.262  15.6212  4.29764  0.55
protocols.relax.FastRelax: {0} MRP: 0  -188.262  -188.262  15.6212  4.29764
protocols.relax.FastRelax: {0} CMD: accept_to_best  -188.262  15.6212  4.29764  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -188.262  15.6212  4.29764  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -188.262  15.6212  4.29764  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -248.542  15.6212  4.29764  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2693 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -272.53  15.6212  4.29764  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -268.626  15.6212  4.29764  0.02805
protocols.relax.FastRelax: {0} CMD: min  -287.517  15.6733  4.12774  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -287.517  15.6733  4.12774  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -167.035  15.6733  4.12774  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2669 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -220.867  15.6733  4.12774  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -216.735  15.6733  4.12774  0.154
protocols.relax.FastRelax: {0} CMD: min  -252.606  15.7696  4.46164  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -252.606  15.7696  4.46164  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -217.957  15.7696  4.46164  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2418 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -221.07  15.7696  4.46164  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -218.287  15.7696  4.46164  0.31955
protocols.relax.FastRelax: {0} CMD: min  -224.942  15.8934  4.76034  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -224.942  15.8934  4.76034  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -185.295  15.8934  4.76034  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2442 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -185.866  15.8934  4.76034  0.55
protocols.relax.FastRelax: {0} CMD: min  -213.058  16.3203  5.85615  0.55
protocols.relax.FastRelax: {0} MRP: 1  -213.058  -213.058  16.3203  5.85615
protocols.relax.FastRelax: {0} CMD: accept_to_best  -213.058  16.3203  5.85615  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -213.058  16.3203  5.85615  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -213.058  16.3203  5.85615  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -275.833  16.3203  5.85615  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2626 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -286.058  16.3203  5.85615  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -283.485  16.3203  5.85615  0.02805
protocols.relax.FastRelax: {0} CMD: min  -329.315  15.9897  4.95907  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -329.315  15.9897  4.95907  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -211.232  15.9897  4.95907  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2638 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -227.719  15.9897  4.95907  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -221.674  15.9897  4.95907  0.154
protocols.relax.FastRelax: {0} CMD: min  -267.62  16.285  5.76242  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -267.62  16.285  5.76242  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -225.365  16.285  5.76242  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2537 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -216.365  16.285  5.76242  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -213.12  16.285  5.76242  0.31955
protocols.relax.FastRelax: {0} CMD: min  -230.662  16.4117  6.08471  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -230.662  16.4117  6.08471  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -190.2  16.4117  6.08471  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2413 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -191.529  16.4117  6.08471  0.55
protocols.relax.FastRelax: {0} CMD: min  -215.621  16.7128  5.77182  0.55
protocols.relax.FastRelax: {0} MRP: 2  -215.621  -215.621  16.7128  5.77182
protocols.relax.FastRelax: {0} CMD: accept_to_best  -215.621  16.7128  5.77182  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -215.621  16.7128  5.77182  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -215.621  16.7128  5.77182  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -278.707  16.7128  5.77182  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2698 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -288.698  16.7128  5.77182  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -285.17  16.7128  5.77182  0.02805
protocols.relax.FastRelax: {0} CMD: min  -340.35  16.3134  4.52243  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -340.35  16.3134  4.52243  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -217.353  16.3134  4.52243  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2884 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -228.766  16.3134  4.52243  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -221.902  16.3134  4.52243  0.154
protocols.relax.FastRelax: {0} CMD: min  -277.328  16.4875  5.03706  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -277.328  16.4875  5.03706  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -234.776  16.4875  5.03706  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2794 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -236.219  16.4875  5.03706  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -232.79  16.4875  5.03706  0.31955
protocols.relax.FastRelax: {0} CMD: min  -247.218  16.6136  5.23149  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -247.218  16.6136  5.23149  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -206.853  16.6136  5.23149  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2497 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -207.139  16.6136  5.23149  0.55
protocols.relax.FastRelax: {0} CMD: min  -226.011  16.7184  4.9673  0.55
protocols.relax.FastRelax: {0} MRP: 3  -226.011  -226.011  16.7184  4.9673
protocols.relax.FastRelax: {0} CMD: accept_to_best  -226.011  16.7184  4.9673  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -226.011  16.7184  4.9673  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -226.011  16.7184  4.9673  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -288.286  16.7184  4.9673  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2638 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -295.635  16.7184  4.9673  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -293.504  16.7184  4.9673  0.02805
protocols.relax.FastRelax: {0} CMD: min  -346.136  16.3083  3.99425  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -346.136  16.3083  3.99425  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -219.968  16.3083  3.99425  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2853 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -229.076  16.3083  3.99425  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -221.868  16.3083  3.99425  0.154
protocols.relax.FastRelax: {0} CMD: min  -282.618  16.4446  4.35159  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -282.618  16.4446  4.35159  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -240.11  16.4446  4.35159  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2597 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -242.331  16.4446  4.35159  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -238.955  16.4446  4.35159  0.31955
protocols.relax.FastRelax: {0} CMD: min  -250.779  16.602  4.53877  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -250.779  16.602  4.53877  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -208.339  16.602  4.53877  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2583 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -208.517  16.602  4.53877  0.55
protocols.relax.FastRelax: {0} CMD: min  -232.097  16.8111  4.84747  0.55
protocols.relax.FastRelax: {0} MRP: 4  -232.097  -232.097  16.8111  4.84747
protocols.relax.FastRelax: {0} CMD: accept_to_best  -232.097  16.8111  4.84747  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -232.097  16.8111  4.84747  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_39.pdb
protocols.relax.FastRelax: {0} CMD: repeat  72206.4  16.0441  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  72206.4  16.0441  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7753.56  16.0441  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2807 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  67.4242  16.0441  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  80.888  16.0441  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -254.478  15.7613  3.04643  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -254.478  15.7613  3.04643  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -106.36  15.7613  3.04643  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2663 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -157.533  15.7613  3.04643  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -150.917  15.7613  3.04643  0.154
protocols.relax.FastRelax: {0} CMD: min  -234.939  15.8413  3.38899  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -234.939  15.8413  3.38899  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -192.117  15.8413  3.38899  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2566 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -196.809  15.8413  3.38899  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -193.53  15.8413  3.38899  0.31955
protocols.relax.FastRelax: {0} CMD: min  -208.507  15.87  3.30992  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -208.507  15.87  3.30992  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -169.873  15.87  3.30992  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2465 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -170.478  15.87  3.30992  0.55
protocols.relax.FastRelax: {0} CMD: min  -219.728  15.9181  3.74432  0.55
protocols.relax.FastRelax: {0} MRP: 0  -219.728  -219.728  15.9181  3.74432
protocols.relax.FastRelax: {0} CMD: accept_to_best  -219.728  15.9181  3.74432  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -219.728  15.9181  3.74432  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -219.728  15.9181  3.74432  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -276.792  15.9181  3.74432  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2742 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -291.394  15.9181  3.74432  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -289.721  15.9181  3.74432  0.02805
protocols.relax.FastRelax: {0} CMD: min  -347.463  15.7388  3.4738  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -347.463  15.7388  3.4738  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -225.508  15.7388  3.4738  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2755 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -238.316  15.7388  3.4738  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -231.716  15.7388  3.4738  0.154
protocols.relax.FastRelax: {0} CMD: min  -292.62  15.7839  3.24537  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -292.62  15.7839  3.24537  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -254.326  15.7839  3.24537  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2641 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -254.448  15.7839  3.24537  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -251.452  15.7839  3.24537  0.31955
protocols.relax.FastRelax: {0} CMD: min  -259.406  15.8397  3.20647  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -259.406  15.8397  3.20647  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -220.887  15.8397  3.20647  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2572 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -220.624  15.8397  3.20647  0.55
protocols.relax.FastRelax: {0} CMD: min  -242.561  16.0219  3.2296  0.55
protocols.relax.FastRelax: {0} MRP: 1  -242.561  -242.561  16.0219  3.2296
protocols.relax.FastRelax: {0} CMD: accept_to_best  -242.561  16.0219  3.2296  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -242.561  16.0219  3.2296  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -242.561  16.0219  3.2296  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -301.541  16.0219  3.2296  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2800 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -313.729  16.0219  3.2296  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -311.931  16.0219  3.2296  0.02805
protocols.relax.FastRelax: {0} CMD: min  -351.856  16.0093  3.14586  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -351.856  16.0093  3.14586  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -237.823  16.0093  3.14586  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2943 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -258.89  16.0093  3.14586  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -253.045  16.0093  3.14586  0.154
protocols.relax.FastRelax: {0} CMD: min  -296.51  16.023  3.11422  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -296.51  16.023  3.11422  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -257.569  16.023  3.11422  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2707 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -257.987  16.023  3.11422  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -254.953  16.023  3.11422  0.31955
protocols.relax.FastRelax: {0} CMD: min  -262.928  16.0575  3.02884  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -262.928  16.0575  3.02884  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -225.405  16.0575  3.02884  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2559 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -225.566  16.0575  3.02884  0.55
protocols.relax.FastRelax: {0} CMD: min  -243.487  16.0429  3.14229  0.55
protocols.relax.FastRelax: {0} MRP: 2  -243.487  -243.487  16.0429  3.14229
protocols.relax.FastRelax: {0} CMD: accept_to_best  -243.487  16.0429  3.14229  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -243.487  16.0429  3.14229  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -243.487  16.0429  3.14229  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -302.472  16.0429  3.14229  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2881 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -313.841  16.0429  3.14229  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -311.99  16.0429  3.14229  0.02805
protocols.relax.FastRelax: {0} CMD: min  -353.519  16.0255  3.13104  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -353.519  16.0255  3.13104  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -239.598  16.0255  3.13104  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2972 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -258.623  16.0255  3.13104  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -252.712  16.0255  3.13104  0.154
protocols.relax.FastRelax: {0} CMD: min  -299.607  16.0594  3.11605  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -299.607  16.0594  3.11605  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -259.373  16.0594  3.11605  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2772 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -259.145  16.0594  3.11605  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -255.968  16.0594  3.11605  0.31955
protocols.relax.FastRelax: {0} CMD: min  -266.487  16.0497  3.12273  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -266.487  16.0497  3.12273  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -226.084  16.0497  3.12273  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2679 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -226.542  16.0497  3.12273  0.55
protocols.relax.FastRelax: {0} CMD: min  -245.231  16.0656  3.10068  0.55
protocols.relax.FastRelax: {0} MRP: 3  -245.231  -245.231  16.0656  3.10068
protocols.relax.FastRelax: {0} CMD: accept_to_best  -245.231  16.0656  3.10068  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -245.231  16.0656  3.10068  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -245.231  16.0656  3.10068  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -304.552  16.0656  3.10068  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2972 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -313.505  16.0656  3.10068  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -311.632  16.0656  3.10068  0.02805
protocols.relax.FastRelax: {0} CMD: min  -364.194  16.1932  3.21419  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -364.194  16.1932  3.21419  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -242.714  16.1932  3.21419  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3008 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -250.885  16.1932  3.21419  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -243.917  16.1932  3.21419  0.154
protocols.relax.FastRelax: {0} CMD: min  -297.094  16.2626  3.02655  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -297.094  16.2626  3.02655  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -253.724  16.2626  3.02655  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2748 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -254.515  16.2626  3.02655  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -251.181  16.2626  3.02655  0.31955
protocols.relax.FastRelax: {0} CMD: min  -263.821  16.2101  3.00879  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -263.821  16.2101  3.00879  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -221.086  16.2101  3.00879  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2684 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -219.533  16.2101  3.00879  0.55
protocols.relax.FastRelax: {0} CMD: min  -243.253  16.2287  2.90929  0.55
protocols.relax.FastRelax: {0} MRP: 4  -243.253  -245.231  16.0656  3.10068
protocols.relax.FastRelax: {0} CMD: accept_to_best  -243.253  16.2287  2.90929  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -243.253  16.2287  2.90929  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_14.pdb
protocols.relax.FastRelax: {0} CMD: repeat  70305  15.3823  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  70305  15.3823  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  6694.8  15.3823  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3947 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -15.4488  15.3823  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  38.0725  15.3823  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -282.927  15.4214  1.68528  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -282.927  15.4214  1.68528  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -104.742  15.4214  1.68528  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3540 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -137.108  15.4214  1.68528  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -128.087  15.4214  1.68528  0.154
protocols.relax.FastRelax: {0} CMD: min  -205.577  15.3766  1.8072  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -205.577  15.3766  1.8072  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -152.455  15.3766  1.8072  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3699 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -153.497  15.3766  1.8072  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -149.374  15.3766  1.8072  0.31955
protocols.relax.FastRelax: {0} CMD: min  -176.45  15.3022  1.88493  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -176.45  15.3022  1.88493  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -127.27  15.3022  1.88493  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3441 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -132.844  15.3022  1.88493  0.55
protocols.relax.FastRelax: {0} CMD: min  -190.447  15.2026  2.38498  0.55
protocols.relax.FastRelax: {0} MRP: 0  -190.447  -190.447  15.2026  2.38498
protocols.relax.FastRelax: {0} CMD: accept_to_best  -190.447  15.2026  2.38498  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -190.447  15.2026  2.38498  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -190.447  15.2026  2.38498  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -260.864  15.2026  2.38498  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 4107 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -284.247  15.2026  2.38498  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -280.203  15.2026  2.38498  0.02805
protocols.relax.FastRelax: {0} CMD: min  -338.355  15.1858  2.43342  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -338.355  15.1858  2.43342  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -176.787  15.1858  2.43342  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3858 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -212.218  15.1858  2.43342  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -205.79  15.1858  2.43342  0.154
protocols.relax.FastRelax: {0} CMD: min  -261.065  15.2312  2.40942  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -261.065  15.2312  2.40942  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -213.852  15.2312  2.40942  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3781 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -214.735  15.2312  2.40942  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -211.066  15.2312  2.40942  0.31955
protocols.relax.FastRelax: {0} CMD: min  -221.239  15.2278  2.45437  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -221.239  15.2278  2.45437  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -172.336  15.2278  2.45437  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3568 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -172.656  15.2278  2.45437  0.55
protocols.relax.FastRelax: {0} CMD: min  -204.661  15.3203  2.41046  0.55
protocols.relax.FastRelax: {0} MRP: 1  -204.661  -204.661  15.3203  2.41046
protocols.relax.FastRelax: {0} CMD: accept_to_best  -204.661  15.3203  2.41046  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -204.661  15.3203  2.41046  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -204.661  15.3203  2.41046  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -275.242  15.3203  2.41046  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 4053 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -295.966  15.3203  2.41046  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -292.324  15.3203  2.41046  0.02805
protocols.relax.FastRelax: {0} CMD: min  -343.56  15.3038  2.45581  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -343.56  15.3038  2.45581  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -169.947  15.3038  2.45581  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 4097 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -218.007  15.3038  2.45581  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -209.895  15.3038  2.45581  0.154
protocols.relax.FastRelax: {0} CMD: min  -281.218  15.3737  2.50438  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -281.218  15.3737  2.50438  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -233.261  15.3737  2.50438  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3808 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -234.074  15.3737  2.50438  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -230.295  15.3737  2.50438  0.31955
protocols.relax.FastRelax: {0} CMD: min  -241.768  15.3638  2.55819  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -241.768  15.3638  2.55819  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -192.364  15.3638  2.55819  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3634 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -192.506  15.3638  2.55819  0.55
protocols.relax.FastRelax: {0} CMD: min  -217.765  15.4187  2.75061  0.55
protocols.relax.FastRelax: {0} MRP: 2  -217.765  -217.765  15.4187  2.75061
protocols.relax.FastRelax: {0} CMD: accept_to_best  -217.765  15.4187  2.75061  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -217.765  15.4187  2.75061  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -217.765  15.4187  2.75061  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -289.163  15.4187  2.75061  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 4076 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -303.349  15.4187  2.75061  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -300.469  15.4187  2.75061  0.02805
protocols.relax.FastRelax: {0} CMD: min  -364.644  15.4613  2.75381  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -364.644  15.4613  2.75381  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -211.803  15.4613  2.75381  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 4000 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -224.909  15.4613  2.75381  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -216.061  15.4613  2.75381  0.154
protocols.relax.FastRelax: {0} CMD: min  -283.73  15.4101  2.69659  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -283.73  15.4101  2.69659  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -230.826  15.4101  2.69659  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3754 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -232.908  15.4101  2.69659  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -228.651  15.4101  2.69659  0.31955
protocols.relax.FastRelax: {0} CMD: min  -248.032  15.413  2.75843  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -248.032  15.413  2.75843  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -197.831  15.413  2.75843  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3645 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -197.216  15.413  2.75843  0.55
protocols.relax.FastRelax: {0} CMD: min  -216.946  15.4248  2.70584  0.55
protocols.relax.FastRelax: {0} MRP: 3  -216.946  -217.765  15.4187  2.75061
protocols.relax.FastRelax: {0} CMD: accept_to_best  -216.946  15.4248  2.70584  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -216.946  15.4248  2.70584  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -216.946  15.4248  2.70584  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -291.294  15.4248  2.70584  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3845 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -304.379  15.4248  2.70584  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -301.167  15.4248  2.70584  0.02805
protocols.relax.FastRelax: {0} CMD: min  -368.131  15.5437  2.67065  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -368.131  15.5437  2.67065  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -208.13  15.5437  2.67065  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3950 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -225.522  15.5437  2.67065  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -216.652  15.5437  2.67065  0.154
protocols.relax.FastRelax: {0} CMD: min  -288.736  15.5342  2.76081  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -288.736  15.5342  2.76081  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -234.331  15.5342  2.76081  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3779 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -234.61  15.5342  2.76081  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -230.346  15.5342  2.76081  0.31955
protocols.relax.FastRelax: {0} CMD: min  -242.826  15.4809  2.81084  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -242.826  15.4809  2.81084  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -187.732  15.4809  2.81084  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3584 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -188.188  15.4809  2.81084  0.55
protocols.relax.FastRelax: {0} CMD: min  -215.413  15.4382  2.78381  0.55
protocols.relax.FastRelax: {0} MRP: 4  -215.413  -217.765  15.4187  2.75061
protocols.relax.FastRelax: {0} CMD: accept_to_best  -215.413  15.4382  2.78381  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -215.413  15.4382  2.78381  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_47.pdb
protocols.relax.FastRelax: {0} CMD: repeat  75885.3  14.8574  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  75885.3  14.8574  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  8083.93  14.8574  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2723 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  114.582  14.8574  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  128.957  14.8574  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -250.814  15.0447  4.95991  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -250.814  15.0447  4.95991  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -124.744  15.0447  4.95991  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3029 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -147.182  15.0447  4.95991  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -140.829  15.0447  4.95991  0.154
protocols.relax.FastRelax: {0} CMD: min  -204.281  15.3218  6.11993  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -204.281  15.3218  6.11993  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -164.691  15.3218  6.11993  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2740 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -167.918  15.3218  6.11993  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -164.867  15.3218  6.11993  0.31955
protocols.relax.FastRelax: {0} CMD: min  -176.211  15.4436  6.19689  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -176.211  15.4436  6.19689  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -134.971  15.4436  6.19689  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2810 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -135.048  15.4436  6.19689  0.55
protocols.relax.FastRelax: {0} CMD: min  -178.674  15.7734  6.21511  0.55
protocols.relax.FastRelax: {0} MRP: 0  -178.674  -178.674  15.7734  6.21511
protocols.relax.FastRelax: {0} CMD: accept_to_best  -178.674  15.7734  6.21511  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -178.674  15.7734  6.21511  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -178.674  15.7734  6.21511  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -237.845  15.7734  6.21511  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2932 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -261.138  15.7734  6.21511  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -257.411  15.7734  6.21511  0.02805
protocols.relax.FastRelax: {0} CMD: min  -305.935  15.4787  5.70776  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -305.935  15.4787  5.70776  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -201.899  15.4787  5.70776  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3148 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -219.664  15.4787  5.70776  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -214.644  15.4787  5.70776  0.154
protocols.relax.FastRelax: {0} CMD: min  -250.552  15.6978  5.57972  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -250.552  15.6978  5.57972  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -210.696  15.6978  5.57972  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3079 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -211.156  15.6978  5.57972  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -208.016  15.6978  5.57972  0.31955
protocols.relax.FastRelax: {0} CMD: min  -217.419  15.7879  5.702  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -217.419  15.7879  5.702  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -179.717  15.7879  5.702  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2830 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -180.178  15.7879  5.702  0.55
protocols.relax.FastRelax: {0} CMD: min  -205.353  15.9249  6.22864  0.55
protocols.relax.FastRelax: {0} MRP: 1  -205.353  -205.353  15.9249  6.22864
protocols.relax.FastRelax: {0} CMD: accept_to_best  -205.353  15.9249  6.22864  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -205.353  15.9249  6.22864  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -205.353  15.9249  6.22864  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -264.381  15.9249  6.22864  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3095 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -276.836  15.9249  6.22864  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -274.472  15.9249  6.22864  0.02805
protocols.relax.FastRelax: {0} CMD: min  -303.881  15.5948  5.66159  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -303.881  15.5948  5.66159  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -215.369  15.5948  5.66159  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3145 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -233.64  15.5948  5.66159  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -229.396  15.5948  5.66159  0.154
protocols.relax.FastRelax: {0} CMD: min  -255.8  15.8402  6.13495  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -255.8  15.8402  6.13495  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -217.314  15.8402  6.13495  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2949 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -219.649  15.8402  6.13495  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -216.668  15.8402  6.13495  0.31955
protocols.relax.FastRelax: {0} CMD: min  -230.684  15.9142  6.28238  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -230.684  15.9142  6.28238  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -194.047  15.9142  6.28238  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2777 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -194.147  15.9142  6.28238  0.55
protocols.relax.FastRelax: {0} CMD: min  -209.216  15.9084  6.52281  0.55
protocols.relax.FastRelax: {0} MRP: 2  -209.216  -209.216  15.9084  6.52281
protocols.relax.FastRelax: {0} CMD: accept_to_best  -209.216  15.9084  6.52281  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -209.216  15.9084  6.52281  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -209.216  15.9084  6.52281  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -267.84  15.9084  6.52281  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2839 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -277.514  15.9084  6.52281  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -275.236  15.9084  6.52281  0.02805
protocols.relax.FastRelax: {0} CMD: min  -296.843  15.7633  6.38942  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -296.843  15.7633  6.38942  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -220.759  15.7633  6.38942  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2918 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -236.973  15.7633  6.38942  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -233.233  15.7633  6.38942  0.154
protocols.relax.FastRelax: {0} CMD: min  -255.996  15.8954  6.44578  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -255.996  15.8954  6.44578  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -222.128  15.8954  6.44578  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2770 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -222.559  15.8954  6.44578  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -219.987  15.8954  6.44578  0.31955
protocols.relax.FastRelax: {0} CMD: min  -230.336  15.9217  6.59018  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -230.336  15.9217  6.59018  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -196.032  15.9217  6.59018  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2711 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -196.262  15.9217  6.59018  0.55
protocols.relax.FastRelax: {0} CMD: min  -209.222  15.8891  6.84773  0.55
protocols.relax.FastRelax: {0} MRP: 3  -209.222  -209.222  15.8891  6.84773
protocols.relax.FastRelax: {0} CMD: accept_to_best  -209.222  15.8891  6.84773  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -209.222  15.8891  6.84773  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -209.222  15.8891  6.84773  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -267.586  15.8891  6.84773  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2879 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -275.734  15.8891  6.84773  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -273.469  15.8891  6.84773  0.02805
protocols.relax.FastRelax: {0} CMD: min  -289.877  15.6084  6.55965  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -289.877  15.6084  6.55965  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -228.264  15.6084  6.55965  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2915 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -243.319  15.6084  6.55965  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -240.469  15.6084  6.55965  0.154
protocols.relax.FastRelax: {0} CMD: min  -257.941  15.7802  6.55905  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -257.941  15.7802  6.55905  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -226.236  15.7802  6.55905  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2865 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -226.689  15.7802  6.55905  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -224.279  15.7802  6.55905  0.31955
protocols.relax.FastRelax: {0} CMD: min  -232.851  15.8264  6.74249  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -232.851  15.8264  6.74249  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -198.129  15.8264  6.74249  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2714 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -198.15  15.8264  6.74249  0.55
protocols.relax.FastRelax: {0} CMD: min  -212.33  15.876  6.69068  0.55
protocols.relax.FastRelax: {0} MRP: 4  -212.33  -212.33  15.876  6.69068
protocols.relax.FastRelax: {0} CMD: accept_to_best  -212.33  15.876  6.69068  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -212.33  15.876  6.69068  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_34.pdb
protocols.relax.FastRelax: {0} CMD: repeat  75006.1  15.6462  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  75006.1  15.6462  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7524.07  15.6462  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2126 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  103.789  15.6462  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  130.435  15.6462  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -270.75  15.8599  4.45274  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -270.75  15.8599  4.45274  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -124.998  15.8599  4.45274  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2659 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -180.508  15.8599  4.45274  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -174.502  15.8599  4.45274  0.154
protocols.relax.FastRelax: {0} CMD: min  -246.393  16.0509  4.83154  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -246.393  16.0509  4.83154  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -204.927  16.0509  4.83154  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2501 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -207.396  16.0509  4.83154  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -204.138  16.0509  4.83154  0.31955
protocols.relax.FastRelax: {0} CMD: min  -228.192  15.979  4.56335  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -228.192  15.979  4.56335  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -190.772  15.979  4.56335  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2535 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -192.402  15.979  4.56335  0.55
protocols.relax.FastRelax: {0} CMD: min  -222.786  16.1072  4.8648  0.55
protocols.relax.FastRelax: {0} MRP: 0  -222.786  -222.786  16.1072  4.8648
protocols.relax.FastRelax: {0} CMD: accept_to_best  -222.786  16.1072  4.8648  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -222.786  16.1072  4.8648  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -222.786  16.1072  4.8648  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -284.598  16.1072  4.8648  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2789 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -297.051  16.1072  4.8648  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -293.719  16.1072  4.8648  0.02805
protocols.relax.FastRelax: {0} CMD: min  -329.593  16.0323  5.38733  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -329.593  16.0323  5.38733  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -192.339  16.0323  5.38733  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2900 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -220.135  16.0323  5.38733  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -213.601  16.0323  5.38733  0.154
protocols.relax.FastRelax: {0} CMD: min  -275.685  16.0533  5.30358  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -275.685  16.0533  5.30358  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -237.039  16.0533  5.30358  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2817 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -238.204  16.0533  5.30358  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -235.322  16.0533  5.30358  0.31955
protocols.relax.FastRelax: {0} CMD: min  -242.922  16.1201  5.10884  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -242.922  16.1201  5.10884  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -201.103  16.1201  5.10884  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2621 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -201.512  16.1201  5.10884  0.55
protocols.relax.FastRelax: {0} CMD: min  -225.926  16.0715  5.10539  0.55
protocols.relax.FastRelax: {0} MRP: 1  -225.926  -225.926  16.0715  5.10539
protocols.relax.FastRelax: {0} CMD: accept_to_best  -225.926  16.0715  5.10539  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -225.926  16.0715  5.10539  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -225.926  16.0715  5.10539  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -286.689  16.0715  5.10539  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2973 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -305.826  16.0715  5.10539  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -301.855  16.0715  5.10539  0.02805
protocols.relax.FastRelax: {0} CMD: min  -354.973  16.0264  5.65892  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -354.973  16.0264  5.65892  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -221.483  16.0264  5.65892  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3081 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -248.422  16.0264  5.65892  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -242.111  16.0264  5.65892  0.154
protocols.relax.FastRelax: {0} CMD: min  -289.502  16.0318  5.47441  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -289.502  16.0318  5.47441  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -247.847  16.0318  5.47441  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2672 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -249.516  16.0318  5.47441  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -246.301  16.0318  5.47441  0.31955
protocols.relax.FastRelax: {0} CMD: min  -258.141  16.0603  5.30077  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -258.141  16.0603  5.30077  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -218.704  16.0603  5.30077  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2638 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -216.781  16.0603  5.30077  0.55
protocols.relax.FastRelax: {0} CMD: min  -232.449  16.0918  5.29182  0.55
protocols.relax.FastRelax: {0} MRP: 2  -232.449  -232.449  16.0918  5.29182
protocols.relax.FastRelax: {0} CMD: accept_to_best  -232.449  16.0918  5.29182  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -232.449  16.0918  5.29182  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -232.449  16.0918  5.29182  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -293.814  16.0918  5.29182  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2900 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -308.788  16.0918  5.29182  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -305.216  16.0918  5.29182  0.02805
protocols.relax.FastRelax: {0} CMD: min  -364.548  15.9905  5.81476  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -364.548  15.9905  5.81476  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -207.424  15.9905  5.81476  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3045 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -241.647  15.9905  5.81476  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -234.222  15.9905  5.81476  0.154
protocols.relax.FastRelax: {0} CMD: min  -293.561  16.079  5.63938  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -293.561  16.079  5.63938  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -248.389  16.079  5.63938  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2796 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -249.369  16.079  5.63938  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -245.895  16.079  5.63938  0.31955
protocols.relax.FastRelax: {0} CMD: min  -256.282  16.1031  5.5328  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -256.282  16.1031  5.5328  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -212.091  16.1031  5.5328  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2671 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -212.919  16.1031  5.5328  0.55
protocols.relax.FastRelax: {0} CMD: min  -237.087  16.1674  5.60392  0.55
protocols.relax.FastRelax: {0} MRP: 3  -237.087  -237.087  16.1674  5.60392
protocols.relax.FastRelax: {0} CMD: accept_to_best  -237.087  16.1674  5.60392  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -237.087  16.1674  5.60392  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -237.087  16.1674  5.60392  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -300.047  16.1674  5.60392  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2845 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -310.409  16.1674  5.60392  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -308.769  16.1674  5.60392  0.02805
protocols.relax.FastRelax: {0} CMD: min  -364.321  16.0167  5.99663  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -364.321  16.0167  5.99663  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -219.677  16.0167  5.99663  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3161 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -243.275  16.0167  5.99663  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -235.433  16.0167  5.99663  0.154
protocols.relax.FastRelax: {0} CMD: min  -302.18  16.1658  5.92469  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -302.18  16.1658  5.92469  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -254.136  16.1658  5.92469  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2801 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -254.089  16.1658  5.92469  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -250.575  16.1658  5.92469  0.31955
protocols.relax.FastRelax: {0} CMD: min  -266.829  16.2636  5.93039  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -266.829  16.2636  5.93039  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -224.373  16.2636  5.93039  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2809 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -224.682  16.2636  5.93039  0.55
protocols.relax.FastRelax: {0} CMD: min  -246.406  16.3181  5.91726  0.55
protocols.relax.FastRelax: {0} MRP: 4  -246.406  -246.406  16.3181  5.91726
protocols.relax.FastRelax: {0} CMD: accept_to_best  -246.406  16.3181  5.91726  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -246.406  16.3181  5.91726  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_41.pdb
protocols.relax.FastRelax: {0} CMD: repeat  68367.8  11.229  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  68367.8  11.229  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  6600.99  11.229  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3310 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  126.96  11.229  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  161.339  11.229  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -40.6424  11.7354  5.02577  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -40.6424  11.7354  5.02577  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  918.27  11.7354  5.02577  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3031 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -124.921  11.7354  5.02577  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -117.078  11.7354  5.02577  0.154
protocols.relax.FastRelax: {0} CMD: min  -225.341  11.7383  5.76336  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -225.341  11.7383  5.76336  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -181.433  11.7383  5.76336  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2785 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -185.451  11.7383  5.76336  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -182.022  11.7383  5.76336  0.31955
protocols.relax.FastRelax: {0} CMD: min  -203.18  11.8718  6.19578  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -203.18  11.8718  6.19578  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -163.94  11.8718  6.19578  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2808 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -165.102  11.8718  6.19578  0.55
protocols.relax.FastRelax: {0} CMD: min  -209.593  11.9429  6.66009  0.55
protocols.relax.FastRelax: {0} MRP: 0  -209.593  -209.593  11.9429  6.66009
protocols.relax.FastRelax: {0} CMD: accept_to_best  -209.593  11.9429  6.66009  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -209.593  11.9429  6.66009  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -209.593  11.9429  6.66009  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -266.848  11.9429  6.66009  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2780 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -283.835  11.9429  6.66009  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -279.383  11.9429  6.66009  0.02805
protocols.relax.FastRelax: {0} CMD: min  -320.877  12.2038  6.60989  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -320.877  12.2038  6.60989  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -206.671  12.2038  6.60989  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2985 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -232.547  12.2038  6.60989  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -227.334  12.2038  6.60989  0.154
protocols.relax.FastRelax: {0} CMD: min  -267.416  12.0036  6.38271  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -267.416  12.0036  6.38271  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -229.606  12.0036  6.38271  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2895 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -231.206  12.0036  6.38271  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -228.259  12.0036  6.38271  0.31955
protocols.relax.FastRelax: {0} CMD: min  -239.992  11.8747  6.42725  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -239.992  11.8747  6.42725  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -200.34  11.8747  6.42725  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2732 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -200.44  11.8747  6.42725  0.55
protocols.relax.FastRelax: {0} CMD: min  -228.833  11.8619  7.11141  0.55
protocols.relax.FastRelax: {0} MRP: 1  -228.833  -228.833  11.8619  7.11141
protocols.relax.FastRelax: {0} CMD: accept_to_best  -228.833  11.8619  7.11141  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -228.833  11.8619  7.11141  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -228.833  11.8619  7.11141  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -286.382  11.8619  7.11141  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3059 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -293.763  11.8619  7.11141  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -291.48  11.8619  7.11141  0.02805
protocols.relax.FastRelax: {0} CMD: min  -333.735  11.9469  6.50616  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -333.735  11.9469  6.50616  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -223.025  11.9469  6.50616  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2989 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -237.708  11.9469  6.50616  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -231.585  11.9469  6.50616  0.154
protocols.relax.FastRelax: {0} CMD: min  -280.67  11.8404  6.79174  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -280.67  11.8404  6.79174  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -244.713  11.8404  6.79174  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2795 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -244.592  11.8404  6.79174  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -241.78  11.8404  6.79174  0.31955
protocols.relax.FastRelax: {0} CMD: min  -251.756  11.8968  7.12997  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -251.756  11.8968  7.12997  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -215.648  11.8968  7.12997  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2640 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -213.601  11.8968  7.12997  0.55
protocols.relax.FastRelax: {0} CMD: min  -230.813  11.8547  7.25225  0.55
protocols.relax.FastRelax: {0} MRP: 2  -230.813  -230.813  11.8547  7.25225
protocols.relax.FastRelax: {0} CMD: accept_to_best  -230.813  11.8547  7.25225  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -230.813  11.8547  7.25225  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -230.813  11.8547  7.25225  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -288.992  11.8547  7.25225  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3019 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -296.528  11.8547  7.25225  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -294.126  11.8547  7.25225  0.02805
protocols.relax.FastRelax: {0} CMD: min  -329.319  11.8822  6.80049  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -329.319  11.8822  6.80049  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -228.201  11.8822  6.80049  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3091 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -249.596  11.8822  6.80049  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -244.785  11.8822  6.80049  0.154
protocols.relax.FastRelax: {0} CMD: min  -282.61  11.7218  7.07131  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -282.61  11.7218  7.07131  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -247.549  11.7218  7.07131  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2794 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -247.865  11.7218  7.07131  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -245.117  11.7218  7.07131  0.31955
protocols.relax.FastRelax: {0} CMD: min  -252.234  11.7274  7.12668  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -252.234  11.7274  7.12668  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -213.955  11.7274  7.12668  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2669 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -214.027  11.7274  7.12668  0.55
protocols.relax.FastRelax: {0} CMD: min  -231.876  11.8106  7.24556  0.55
protocols.relax.FastRelax: {0} MRP: 3  -231.876  -231.876  11.8106  7.24556
protocols.relax.FastRelax: {0} CMD: accept_to_best  -231.876  11.8106  7.24556  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -231.876  11.8106  7.24556  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -231.876  11.8106  7.24556  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -290.29  11.8106  7.24556  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2954 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -299.06  11.8106  7.24556  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -296.278  11.8106  7.24556  0.02805
protocols.relax.FastRelax: {0} CMD: min  -332.419  11.901  6.77415  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -332.419  11.901  6.77415  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -231.089  11.901  6.77415  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2966 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -246.543  11.901  6.77415  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -241.36  11.901  6.77415  0.154
protocols.relax.FastRelax: {0} CMD: min  -284.197  11.8552  7.12971  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -284.197  11.8552  7.12971  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -249.36  11.8552  7.12971  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2804 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -250.052  11.8552  7.12971  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -247.311  11.8552  7.12971  0.31955
protocols.relax.FastRelax: {0} CMD: min  -254.137  11.8422  7.11511  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -254.137  11.8422  7.11511  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -215.399  11.8422  7.11511  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2668 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -216.209  11.8422  7.11511  0.55
protocols.relax.FastRelax: {0} CMD: min  -231.505  11.8168  7.26989  0.55
protocols.relax.FastRelax: {0} MRP: 4  -231.505  -231.876  11.8106  7.24556
protocols.relax.FastRelax: {0} CMD: accept_to_best  -231.505  11.8168  7.26989  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -231.505  11.8168  7.26989  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_22.pdb
protocols.relax.FastRelax: {0} CMD: repeat  72848.1  13.7828  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  72848.1  13.7828  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7069.36  13.7828  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3068 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  240.913  13.7828  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  295.845  13.7828  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -205.355  11.7673  4.83728  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -205.355  11.7673  4.83728  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -68.7414  11.7673  4.83728  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2395 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -92.2366  11.7673  4.83728  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -84.8532  11.7673  4.83728  0.154
protocols.relax.FastRelax: {0} CMD: min  -175.941  12.2621  4.26808  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -175.941  12.2621  4.26808  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -133.207  12.2621  4.26808  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2232 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -136.65  12.2621  4.26808  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -133.288  12.2621  4.26808  0.31955
protocols.relax.FastRelax: {0} CMD: min  -145.288  12.3907  4.16608  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -145.288  12.3907  4.16608  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -99.5827  12.3907  4.16608  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2202 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -99.5368  12.3907  4.16608  0.55
protocols.relax.FastRelax: {0} CMD: min  -162.963  11.8967  4.93776  0.55
protocols.relax.FastRelax: {0} MRP: 0  -162.963  -162.963  11.8967  4.93776
protocols.relax.FastRelax: {0} CMD: accept_to_best  -162.963  11.8967  4.93776  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -162.963  11.8967  4.93776  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -162.963  11.8967  4.93776  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -229.622  11.8967  4.93776  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2656 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -249.082  11.8967  4.93776  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -245.653  11.8967  4.93776  0.02805
protocols.relax.FastRelax: {0} CMD: min  -291.844  11.8621  4.45842  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -291.844  11.8621  4.45842  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -174.853  11.8621  4.45842  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2750 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -203.112  11.8621  4.45842  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -197.898  11.8621  4.45842  0.154
protocols.relax.FastRelax: {0} CMD: min  -237.76  11.8746  4.69888  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -237.76  11.8746  4.69888  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -197.539  11.8746  4.69888  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2493 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -198.272  11.8746  4.69888  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -195.097  11.8746  4.69888  0.31955
protocols.relax.FastRelax: {0} CMD: min  -204.735  11.8669  4.83838  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -204.735  11.8669  4.83838  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -161.595  11.8669  4.83838  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2452 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -161.956  11.8669  4.83838  0.55
protocols.relax.FastRelax: {0} CMD: min  -191.257  11.7499  5.05079  0.55
protocols.relax.FastRelax: {0} MRP: 1  -191.257  -191.257  11.7499  5.05079
protocols.relax.FastRelax: {0} CMD: accept_to_best  -191.257  11.7499  5.05079  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -191.257  11.7499  5.05079  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -191.257  11.7499  5.05079  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -257.099  11.7499  5.05079  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2651 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -269.455  11.7499  5.05079  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -266.795  11.7499  5.05079  0.02805
protocols.relax.FastRelax: {0} CMD: min  -303.008  11.7777  4.47062  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -303.008  11.7777  4.47062  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -205.331  11.7777  4.47062  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2669 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -227.027  11.7777  4.47062  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -222.489  11.7777  4.47062  0.154
protocols.relax.FastRelax: {0} CMD: min  -250.918  11.7414  4.71744  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -250.918  11.7414  4.71744  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -211.731  11.7414  4.71744  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2470 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -212.239  11.7414  4.71744  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -209.181  11.7414  4.71744  0.31955
protocols.relax.FastRelax: {0} CMD: min  -219.567  11.7117  4.92255  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -219.567  11.7117  4.92255  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -178.257  11.7117  4.92255  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2391 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -178.203  11.7117  4.92255  0.55
protocols.relax.FastRelax: {0} CMD: min  -194.909  11.659  5.09077  0.55
protocols.relax.FastRelax: {0} MRP: 2  -194.909  -194.909  11.659  5.09077
protocols.relax.FastRelax: {0} CMD: accept_to_best  -194.909  11.659  5.09077  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -194.909  11.659  5.09077  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -194.909  11.659  5.09077  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -261.271  11.659  5.09077  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2666 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -274.112  11.659  5.09077  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -271.238  11.659  5.09077  0.02805
protocols.relax.FastRelax: {0} CMD: min  -311.859  11.7311  4.48834  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -311.859  11.7311  4.48834  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -206.475  11.7311  4.48834  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2696 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -227.315  11.7311  4.48834  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -222.503  11.7311  4.48834  0.154
protocols.relax.FastRelax: {0} CMD: min  -250.81  11.7256  4.65066  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -250.81  11.7256  4.65066  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -208.685  11.7256  4.65066  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2580 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -209.638  11.7256  4.65066  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -206.424  11.7256  4.65066  0.31955
protocols.relax.FastRelax: {0} CMD: min  -220.151  11.668  4.91688  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -220.151  11.668  4.91688  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -178.585  11.668  4.91688  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2420 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -178.601  11.668  4.91688  0.55
protocols.relax.FastRelax: {0} CMD: min  -195.515  11.7005  4.97389  0.55
protocols.relax.FastRelax: {0} MRP: 3  -195.515  -195.515  11.7005  4.97389
protocols.relax.FastRelax: {0} CMD: accept_to_best  -195.515  11.7005  4.97389  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -195.515  11.7005  4.97389  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -195.515  11.7005  4.97389  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -261.988  11.7005  4.97389  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2662 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -274.071  11.7005  4.97389  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -271.363  11.7005  4.97389  0.02805
protocols.relax.FastRelax: {0} CMD: min  -317.996  11.7442  4.33747  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -317.996  11.7442  4.33747  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -192.619  11.7442  4.33747  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2800 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -219.991  11.7442  4.33747  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -214.207  11.7442  4.33747  0.154
protocols.relax.FastRelax: {0} CMD: min  -256.459  11.822  4.42055  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -256.459  11.822  4.42055  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -211.741  11.822  4.42055  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2641 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -211.772  11.822  4.42055  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -208.3  11.822  4.42055  0.31955
protocols.relax.FastRelax: {0} CMD: min  -222.244  11.7998  4.62259  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -222.244  11.7998  4.62259  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -179.195  11.7998  4.62259  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2514 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -179.46  11.7998  4.62259  0.55
protocols.relax.FastRelax: {0} CMD: min  -201.081  11.6074  5.07716  0.55
protocols.relax.FastRelax: {0} MRP: 4  -201.081  -201.081  11.6074  5.07716
protocols.relax.FastRelax: {0} CMD: accept_to_best  -201.081  11.6074  5.07716  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -201.081  11.6074  5.07716  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_37.pdb
protocols.relax.FastRelax: {0} CMD: repeat  76828.4  13.6951  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  76828.4  13.6951  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7436.3  13.6951  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3502 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  7.38801  13.6951  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  61.5738  13.6951  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -237.82  13.6248  2.33159  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -237.82  13.6248  2.33159  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -79.2973  13.6248  2.33159  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2890 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -94.0763  13.6248  2.33159  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -84.5149  13.6248  2.33159  0.154
protocols.relax.FastRelax: {0} CMD: min  -180.459  13.566  2.48514  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -180.459  13.566  2.48514  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -135.978  13.566  2.48514  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2407 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -138.251  13.566  2.48514  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -134.792  13.566  2.48514  0.31955
protocols.relax.FastRelax: {0} CMD: min  -166.111  13.6335  2.62419  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -166.111  13.6335  2.62419  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -128.471  13.6335  2.62419  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2355 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -128.898  13.6335  2.62419  0.55
protocols.relax.FastRelax: {0} CMD: min  -165.959  13.6108  3.53049  0.55
protocols.relax.FastRelax: {0} MRP: 0  -165.959  -165.959  13.6108  3.53049
protocols.relax.FastRelax: {0} CMD: accept_to_best  -165.959  13.6108  3.53049  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -165.959  13.6108  3.53049  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -165.959  13.6108  3.53049  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -229.371  13.6108  3.53049  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2714 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -242.569  13.6108  3.53049  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -238.304  13.6108  3.53049  0.02805
protocols.relax.FastRelax: {0} CMD: min  -295.931  13.5897  3.54214  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -295.931  13.5897  3.54214  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -164.548  13.5897  3.54214  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2862 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -188.798  13.5897  3.54214  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -182.847  13.5897  3.54214  0.154
protocols.relax.FastRelax: {0} CMD: min  -235.622  13.5881  3.65083  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -235.622  13.5881  3.65083  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -198.161  13.5881  3.65083  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2504 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -198.506  13.5881  3.65083  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -195.571  13.5881  3.65083  0.31955
protocols.relax.FastRelax: {0} CMD: min  -203.031  13.6171  3.7029  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -203.031  13.6171  3.7029  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -163.634  13.6171  3.7029  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2420 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -164.015  13.6171  3.7029  0.55
protocols.relax.FastRelax: {0} CMD: min  -189  13.5576  4.12839  0.55
protocols.relax.FastRelax: {0} MRP: 1  -189  -189  13.5576  4.12839
protocols.relax.FastRelax: {0} CMD: accept_to_best  -189  13.5576  4.12839  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -189  13.5576  4.12839  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -189  13.5576  4.12839  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -250.969  13.5576  4.12839  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2772 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -261.363  13.5576  4.12839  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -257.316  13.5576  4.12839  0.02805
protocols.relax.FastRelax: {0} CMD: min  -312.847  13.435  3.95806  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -312.847  13.435  3.95806  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -188.154  13.435  3.95806  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2747 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -202.353  13.435  3.95806  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -195.504  13.435  3.95806  0.154
protocols.relax.FastRelax: {0} CMD: min  -258.156  13.4599  4.04072  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -258.156  13.4599  4.04072  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -216.461  13.4599  4.04072  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2630 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -216.595  13.4599  4.04072  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -213.35  13.4599  4.04072  0.31955
protocols.relax.FastRelax: {0} CMD: min  -220.75  13.5149  4.049  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -220.75  13.5149  4.049  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -177.006  13.5149  4.049  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2529 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -177.433  13.5149  4.049  0.55
protocols.relax.FastRelax: {0} CMD: min  -195.211  13.5999  4.12627  0.55
protocols.relax.FastRelax: {0} MRP: 2  -195.211  -195.211  13.5999  4.12627
protocols.relax.FastRelax: {0} CMD: accept_to_best  -195.211  13.5999  4.12627  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -195.211  13.5999  4.12627  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -195.211  13.5999  4.12627  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -259.473  13.5999  4.12627  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2766 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -268.204  13.5999  4.12627  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -264.93  13.5999  4.12627  0.02805
protocols.relax.FastRelax: {0} CMD: min  -315.279  13.5894  3.94619  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -315.279  13.5894  3.94619  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -204.934  13.5894  3.94619  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2725 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -213.087  13.5894  3.94619  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -206.395  13.5894  3.94619  0.154
protocols.relax.FastRelax: {0} CMD: min  -260.427  13.5136  4.10456  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -260.427  13.5136  4.10456  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -218.534  13.5136  4.10456  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2549 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -218.634  13.5136  4.10456  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -215.362  13.5136  4.10456  0.31955
protocols.relax.FastRelax: {0} CMD: min  -222.731  13.5406  4.15567  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -222.731  13.5406  4.15567  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -178.117  13.5406  4.15567  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2397 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -178.543  13.5406  4.15567  0.55
protocols.relax.FastRelax: {0} CMD: min  -197.245  13.5726  4.15014  0.55
protocols.relax.FastRelax: {0} MRP: 3  -197.245  -197.245  13.5726  4.15014
protocols.relax.FastRelax: {0} CMD: accept_to_best  -197.245  13.5726  4.15014  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -197.245  13.5726  4.15014  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -197.245  13.5726  4.15014  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -261.588  13.5726  4.15014  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2741 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -266.903  13.5726  4.15014  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -264.842  13.5726  4.15014  0.02805
protocols.relax.FastRelax: {0} CMD: min  -320.467  13.5807  4.05225  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -320.467  13.5807  4.05225  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -197.723  13.5807  4.05225  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2724 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -206.327  13.5807  4.05225  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -199.336  13.5807  4.05225  0.154
protocols.relax.FastRelax: {0} CMD: min  -259.876  13.4825  4.19065  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -259.876  13.4825  4.19065  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -218.248  13.4825  4.19065  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2583 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -218.339  13.4825  4.19065  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -215.087  13.4825  4.19065  0.31955
protocols.relax.FastRelax: {0} CMD: min  -223.992  13.4627  4.23581  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -223.992  13.4627  4.23581  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -181.527  13.4627  4.23581  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2495 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -181.804  13.4627  4.23581  0.55
protocols.relax.FastRelax: {0} CMD: min  -198.843  13.5671  4.23461  0.55
protocols.relax.FastRelax: {0} MRP: 4  -198.843  -198.843  13.5671  4.23461
protocols.relax.FastRelax: {0} CMD: accept_to_best  -198.843  13.5671  4.23461  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -198.843  13.5671  4.23461  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_44.pdb
protocols.relax.FastRelax: {0} CMD: repeat  70147.5  17.9952  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  70147.5  17.9952  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7295.3  17.9952  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2893 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  222.343  17.9952  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  268.325  17.9952  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -236.998  17.281  3.75663  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -236.998  17.281  3.75663  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -121.368  17.281  3.75663  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2860 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -138.437  17.281  3.75663  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -132.399  17.281  3.75663  0.154
protocols.relax.FastRelax: {0} CMD: min  -205.551  17.2393  4.99128  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -205.551  17.2393  4.99128  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -162.438  17.2393  4.99128  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2841 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -165.573  17.2393  4.99128  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -162.332  17.2393  4.99128  0.31955
protocols.relax.FastRelax: {0} CMD: min  -176.653  17.383  4.94019  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -176.653  17.383  4.94019  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -136.15  17.383  4.94019  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2724 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -130.485  17.383  4.94019  0.55
protocols.relax.FastRelax: {0} CMD: min  -160.909  17.0593  5.74163  0.55
protocols.relax.FastRelax: {0} MRP: 0  -160.909  -160.909  17.0593  5.74163
protocols.relax.FastRelax: {0} CMD: accept_to_best  -160.909  17.0593  5.74163  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -160.909  17.0593  5.74163  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -160.909  17.0593  5.74163  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -220.053  17.0593  5.74163  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3115 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -238.973  17.0593  5.74163  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -235.707  17.0593  5.74163  0.02805
protocols.relax.FastRelax: {0} CMD: min  -279.858  16.6774  5.68474  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -279.858  16.6774  5.68474  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -164.438  16.6774  5.68474  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2823 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -187.316  16.6774  5.68474  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -181.918  16.6774  5.68474  0.154
protocols.relax.FastRelax: {0} CMD: min  -228.294  16.8796  5.55211  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -228.294  16.8796  5.55211  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -190.608  16.8796  5.55211  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2733 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -190.732  16.8796  5.55211  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -187.816  16.8796  5.55211  0.31955
protocols.relax.FastRelax: {0} CMD: min  -194.283  16.9792  5.50372  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -194.283  16.9792  5.50372  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -154.797  16.9792  5.50372  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2556 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -154.815  16.9792  5.50372  0.55
protocols.relax.FastRelax: {0} CMD: min  -176.414  17.2279  4.9327  0.55
protocols.relax.FastRelax: {0} MRP: 1  -176.414  -176.414  17.2279  4.9327
protocols.relax.FastRelax: {0} CMD: accept_to_best  -176.414  17.2279  4.9327  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -176.414  17.2279  4.9327  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -176.414  17.2279  4.9327  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -236.429  17.2279  4.9327  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2880 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -250.818  17.2279  4.9327  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -248.809  17.2279  4.9327  0.02805
protocols.relax.FastRelax: {0} CMD: min  -294.911  16.831  4.92804  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -294.911  16.831  4.92804  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -185.207  16.831  4.92804  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2773 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -206.381  16.831  4.92804  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -201.218  16.831  4.92804  0.154
protocols.relax.FastRelax: {0} CMD: min  -237.214  16.9406  5.13258  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -237.214  16.9406  5.13258  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -197.841  16.9406  5.13258  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2621 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -199.909  16.9406  5.13258  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -196.907  16.9406  5.13258  0.31955
protocols.relax.FastRelax: {0} CMD: min  -211.442  16.9953  5.20428  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -211.442  16.9953  5.20428  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -174.687  16.9953  5.20428  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2388 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -174.887  16.9953  5.20428  0.55
protocols.relax.FastRelax: {0} CMD: min  -190.442  17.1297  5.11068  0.55
protocols.relax.FastRelax: {0} MRP: 2  -190.442  -190.442  17.1297  5.11068
protocols.relax.FastRelax: {0} CMD: accept_to_best  -190.442  17.1297  5.11068  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -190.442  17.1297  5.11068  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -190.442  17.1297  5.11068  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -251.41  17.1297  5.11068  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2969 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -260.354  17.1297  5.11068  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -258.376  17.1297  5.11068  0.02805
protocols.relax.FastRelax: {0} CMD: min  -308.966  16.7029  5.17588  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -308.966  16.7029  5.17588  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -193.141  16.7029  5.17588  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2792 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -206.43  16.7029  5.17588  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -200.378  16.7029  5.17588  0.154
protocols.relax.FastRelax: {0} CMD: min  -251.226  16.93  5.04307  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -251.226  16.93  5.04307  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -211.65  16.93  5.04307  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2668 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -212.152  16.93  5.04307  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -209.086  16.93  5.04307  0.31955
protocols.relax.FastRelax: {0} CMD: min  -216.144  17.0107  5.04953  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -216.144  17.0107  5.04953  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -170.743  17.0107  5.04953  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2598 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -170.858  17.0107  5.04953  0.55
protocols.relax.FastRelax: {0} CMD: min  -194.293  17.2376  4.94055  0.55
protocols.relax.FastRelax: {0} MRP: 3  -194.293  -194.293  17.2376  4.94055
protocols.relax.FastRelax: {0} CMD: accept_to_best  -194.293  17.2376  4.94055  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -194.293  17.2376  4.94055  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -194.293  17.2376  4.94055  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -256.523  17.2376  4.94055  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3065 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -266.651  17.2376  4.94055  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -264.251  17.2376  4.94055  0.02805
protocols.relax.FastRelax: {0} CMD: min  -313.318  16.8439  4.92377  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -313.318  16.8439  4.92377  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -196.576  16.8439  4.92377  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2886 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -211.474  16.8439  4.92377  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -205.36  16.8439  4.92377  0.154
protocols.relax.FastRelax: {0} CMD: min  -244.06  16.8714  5.11813  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -244.06  16.8714  5.11813  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -197.414  16.8714  5.11813  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2709 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -198.601  16.8714  5.11813  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -194.886  16.8714  5.11813  0.31955
protocols.relax.FastRelax: {0} CMD: min  -216.829  17.0881  5.03199  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -216.829  17.0881  5.03199  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -175.391  17.0881  5.03199  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2527 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -175.557  17.0881  5.03199  0.55
protocols.relax.FastRelax: {0} CMD: min  -197.578  17.2059  4.99029  0.55
protocols.relax.FastRelax: {0} MRP: 4  -197.578  -197.578  17.2059  4.99029
protocols.relax.FastRelax: {0} CMD: accept_to_best  -197.578  17.2059  4.99029  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -197.578  17.2059  4.99029  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_13.pdb
protocols.relax.FastRelax: {0} CMD: repeat  69421.8  15.3653  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  69421.8  15.3653  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  6745.87  15.3653  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2691 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -112.863  15.3653  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -93.9666  15.3653  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -298.475  15.6761  3.04865  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -298.475  15.6761  3.04865  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -137.293  15.6761  3.04865  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2844 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -159.178  15.6761  3.04865  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -150.204  15.6761  3.04865  0.154
protocols.relax.FastRelax: {0} CMD: min  -248.316  15.7923  3.03554  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -248.316  15.7923  3.03554  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -198.588  15.7923  3.03554  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2920 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -201.82  15.7923  3.03554  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -198.068  15.7923  3.03554  0.31955
protocols.relax.FastRelax: {0} CMD: min  -209.413  15.867  3.06166  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -209.413  15.867  3.06166  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -160.139  15.867  3.06166  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2599 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -160.846  15.867  3.06166  0.55
protocols.relax.FastRelax: {0} CMD: min  -198.136  16.1878  3.5967  0.55
protocols.relax.FastRelax: {0} MRP: 0  -198.136  -198.136  16.1878  3.5967
protocols.relax.FastRelax: {0} CMD: accept_to_best  -198.136  16.1878  3.5967  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -198.136  16.1878  3.5967  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -198.136  16.1878  3.5967  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -262.054  16.1878  3.5967  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3334 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -273.563  16.1878  3.5967  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -270.678  16.1878  3.5967  0.02805
protocols.relax.FastRelax: {0} CMD: min  -345.863  15.7766  3.61174  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -345.863  15.7766  3.61174  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -201.151  15.7766  3.61174  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3222 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -215.173  15.7766  3.61174  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -206.985  15.7766  3.61174  0.154
protocols.relax.FastRelax: {0} CMD: min  -268.228  15.8607  3.4693  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -268.228  15.8607  3.4693  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -214.942  15.8607  3.4693  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2887 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -215.62  15.8607  3.4693  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -211.547  15.8607  3.4693  0.31955
protocols.relax.FastRelax: {0} CMD: min  -231.222  16.0329  3.56577  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -231.222  16.0329  3.56577  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -187.009  16.0329  3.56577  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2673 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -187.013  16.0329  3.56577  0.55
protocols.relax.FastRelax: {0} CMD: min  -214.157  16.3608  3.60248  0.55
protocols.relax.FastRelax: {0} MRP: 1  -214.157  -214.157  16.3608  3.60248
protocols.relax.FastRelax: {0} CMD: accept_to_best  -214.157  16.3608  3.60248  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -214.157  16.3608  3.60248  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -214.157  16.3608  3.60248  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -277.37  16.3608  3.60248  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3363 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -288.41  16.3608  3.60248  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -285.991  16.3608  3.60248  0.02805
protocols.relax.FastRelax: {0} CMD: min  -348.714  15.835  3.65179  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -348.714  15.835  3.65179  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -199.428  15.835  3.65179  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3408 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -218.06  15.835  3.65179  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -209.953  15.835  3.65179  0.154
protocols.relax.FastRelax: {0} CMD: min  -278.307  15.9782  3.48578  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -278.307  15.9782  3.48578  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -231.153  15.9782  3.48578  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2960 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -231.664  15.9782  3.48578  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -227.991  15.9782  3.48578  0.31955
protocols.relax.FastRelax: {0} CMD: min  -239.071  16.0106  3.4445  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -239.071  16.0106  3.4445  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -191.41  16.0106  3.4445  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2873 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -191.519  16.0106  3.4445  0.55
protocols.relax.FastRelax: {0} CMD: min  -219.769  15.6343  3.50334  0.55
protocols.relax.FastRelax: {0} MRP: 2  -219.769  -219.769  15.6343  3.50334
protocols.relax.FastRelax: {0} CMD: accept_to_best  -219.769  15.6343  3.50334  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -219.769  15.6343  3.50334  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -219.769  15.6343  3.50334  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -284.245  15.6343  3.50334  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3318 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -296.436  15.6343  3.50334  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -294.153  15.6343  3.50334  0.02805
protocols.relax.FastRelax: {0} CMD: min  -350.416  15.3463  3.80489  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -350.416  15.3463  3.80489  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -210.001  15.3463  3.80489  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3282 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -228.545  15.3463  3.80489  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -220.699  15.3463  3.80489  0.154
protocols.relax.FastRelax: {0} CMD: min  -281.338  15.3374  3.60069  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -281.338  15.3374  3.60069  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -233.201  15.3374  3.60069  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2976 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -234.767  15.3374  3.60069  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -230.954  15.3374  3.60069  0.31955
protocols.relax.FastRelax: {0} CMD: min  -245.964  15.4725  3.64955  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -245.964  15.4725  3.64955  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -197.813  15.4725  3.64955  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2874 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -198.088  15.4725  3.64955  0.55
protocols.relax.FastRelax: {0} CMD: min  -212.382  15.6152  3.65448  0.55
protocols.relax.FastRelax: {0} MRP: 3  -212.382  -219.769  15.6343  3.50334
protocols.relax.FastRelax: {0} CMD: accept_to_best  -212.382  15.6152  3.65448  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -212.382  15.6152  3.65448  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -212.382  15.6152  3.65448  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -283.879  15.6152  3.65448  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3384 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -294.744  15.6152  3.65448  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -292.838  15.6152  3.65448  0.02805
protocols.relax.FastRelax: {0} CMD: min  -345.339  15.3379  3.78514  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -345.339  15.3379  3.78514  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -227.172  15.3379  3.78514  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3143 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -244.915  15.3379  3.78514  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -238.53  15.3379  3.78514  0.154
protocols.relax.FastRelax: {0} CMD: min  -287.267  15.404  3.73365  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -287.267  15.404  3.73365  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -241.724  15.404  3.73365  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2942 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -241.974  15.404  3.73365  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -238.402  15.404  3.73365  0.31955
protocols.relax.FastRelax: {0} CMD: min  -249.413  15.4843  3.69294  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -249.413  15.4843  3.69294  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -202.852  15.4843  3.69294  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2816 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -202.907  15.4843  3.69294  0.55
protocols.relax.FastRelax: {0} CMD: min  -224.865  15.6702  3.58323  0.55
protocols.relax.FastRelax: {0} MRP: 4  -224.865  -224.865  15.6702  3.58323
protocols.relax.FastRelax: {0} CMD: accept_to_best  -224.865  15.6702  3.58323  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -224.865  15.6702  3.58323  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_42.pdb
protocols.relax.FastRelax: {0} CMD: repeat  71840.7  13.4266  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  71840.7  13.4266  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  6710.87  13.4266  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2799 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  125.355  13.4266  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  158.62  13.4266  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -256.769  14.0069  5.47487  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -256.769  14.0069  5.47487  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -93.8691  14.0069  5.47487  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2980 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -126.819  14.0069  5.47487  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -118.685  14.0069  5.47487  0.154
protocols.relax.FastRelax: {0} CMD: min  -231.181  13.5935  5.76533  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -231.181  13.5935  5.76533  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -188.929  13.5935  5.76533  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2440 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -192.568  13.5935  5.76533  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -189.379  13.5935  5.76533  0.31955
protocols.relax.FastRelax: {0} CMD: min  -204.634  13.7628  6.01317  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -204.634  13.7628  6.01317  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -162.17  13.7628  6.01317  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2349 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -163.142  13.7628  6.01317  0.55
protocols.relax.FastRelax: {0} CMD: min  -208.351  13.8389  6.06984  0.55
protocols.relax.FastRelax: {0} MRP: 0  -208.351  -208.351  13.8389  6.06984
protocols.relax.FastRelax: {0} CMD: accept_to_best  -208.351  13.8389  6.06984  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -208.351  13.8389  6.06984  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -208.351  13.8389  6.06984  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -265.932  13.8389  6.06984  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2460 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -284.752  13.8389  6.06984  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -279.799  13.8389  6.06984  0.02805
protocols.relax.FastRelax: {0} CMD: min  -316.105  13.4002  6.39615  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -316.105  13.4002  6.39615  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -180.745  13.4002  6.39615  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2723 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -228.641  13.4002  6.39615  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -224.034  13.4002  6.39615  0.154
protocols.relax.FastRelax: {0} CMD: min  -257.528  13.6138  6.23178  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -257.528  13.6138  6.23178  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -221.802  13.6138  6.23178  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2580 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -224.32  13.6138  6.23178  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -221.44  13.6138  6.23178  0.31955
protocols.relax.FastRelax: {0} CMD: min  -229.666  13.6962  6.14368  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -229.666  13.6962  6.14368  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -190.259  13.6962  6.14368  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2276 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -191.301  13.6962  6.14368  0.55
protocols.relax.FastRelax: {0} CMD: min  -217.937  13.6121  6.09797  0.55
protocols.relax.FastRelax: {0} MRP: 1  -217.937  -217.937  13.6121  6.09797
protocols.relax.FastRelax: {0} CMD: accept_to_best  -217.937  13.6121  6.09797  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -217.937  13.6121  6.09797  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -217.937  13.6121  6.09797  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -277.13  13.6121  6.09797  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2611 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -291.817  13.6121  6.09797  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -287.966  13.6121  6.09797  0.02805
protocols.relax.FastRelax: {0} CMD: min  -330.058  13.3493  6.53053  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -330.058  13.3493  6.53053  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -216.275  13.3493  6.53053  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2654 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -241.308  13.3493  6.53053  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -235.851  13.3493  6.53053  0.154
protocols.relax.FastRelax: {0} CMD: min  -273.121  13.47  6.12797  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -273.121  13.47  6.12797  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -230.612  13.47  6.12797  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2452 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -231.642  13.47  6.12797  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -228.377  13.47  6.12797  0.31955
protocols.relax.FastRelax: {0} CMD: min  -238.662  13.5624  6.05324  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -238.662  13.5624  6.05324  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -193.891  13.5624  6.05324  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2363 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -194.811  13.5624  6.05324  0.55
protocols.relax.FastRelax: {0} CMD: min  -226.41  13.6336  5.12962  0.55
protocols.relax.FastRelax: {0} MRP: 2  -226.41  -226.41  13.6336  5.12962
protocols.relax.FastRelax: {0} CMD: accept_to_best  -226.41  13.6336  5.12962  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -226.41  13.6336  5.12962  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -226.41  13.6336  5.12962  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -285.973  13.6336  5.12962  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2502 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -298.252  13.6336  5.12962  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -295.413  13.6336  5.12962  0.02805
protocols.relax.FastRelax: {0} CMD: min  -345.616  13.4467  5.92873  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -345.616  13.4467  5.92873  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -216.165  13.4467  5.92873  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2701 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -234.888  13.4467  5.92873  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -227.616  13.4467  5.92873  0.154
protocols.relax.FastRelax: {0} CMD: min  -285.257  13.558  5.82926  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -285.257  13.558  5.82926  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -243.228  13.558  5.82926  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2490 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -243.643  13.558  5.82926  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -240.409  13.558  5.82926  0.31955
protocols.relax.FastRelax: {0} CMD: min  -249.108  13.5468  5.62386  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -249.108  13.5468  5.62386  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -207.235  13.5468  5.62386  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2297 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -207.688  13.5468  5.62386  0.55
protocols.relax.FastRelax: {0} CMD: min  -232.734  13.6986  5.48224  0.55
protocols.relax.FastRelax: {0} MRP: 3  -232.734  -232.734  13.6986  5.48224
protocols.relax.FastRelax: {0} CMD: accept_to_best  -232.734  13.6986  5.48224  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -232.734  13.6986  5.48224  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -232.734  13.6986  5.48224  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -293.962  13.6986  5.48224  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2681 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -305.127  13.6986  5.48224  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -302.808  13.6986  5.48224  0.02805
protocols.relax.FastRelax: {0} CMD: min  -324.37  13.609  5.69577  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -324.37  13.609  5.69577  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -237.004  13.609  5.69577  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2734 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -262.101  13.609  5.69577  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -258.542  13.609  5.69577  0.154
protocols.relax.FastRelax: {0} CMD: min  -279.177  13.6797  5.64777  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -279.177  13.6797  5.64777  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -243.941  13.6797  5.64777  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2611 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -237.505  13.6797  5.64777  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -234.705  13.6797  5.64777  0.31955
protocols.relax.FastRelax: {0} CMD: min  -246.306  13.7212  5.57732  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -246.306  13.7212  5.57732  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -208.684  13.7212  5.57732  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2526 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -209.335  13.7212  5.57732  0.55
protocols.relax.FastRelax: {0} CMD: min  -231.614  13.767  5.51063  0.55
protocols.relax.FastRelax: {0} MRP: 4  -231.614  -232.734  13.6986  5.48224
protocols.relax.FastRelax: {0} CMD: accept_to_best  -231.614  13.767  5.51063  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -231.614  13.767  5.51063  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_17.pdb
protocols.relax.FastRelax: {0} CMD: repeat  66089.1  14.2547  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  66089.1  14.2547  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7281.56  14.2547  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3089 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  160.207  14.2547  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  184.639  14.2547  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -191.293  14.2801  7.96765  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -191.293  14.2801  7.96765  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -100.839  14.2801  7.96765  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 1900 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -126.572  14.2801  7.96765  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -121.812  14.2801  7.96765  0.154
protocols.relax.FastRelax: {0} CMD: min  -160.793  14.1424  7.0282  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -160.793  14.1424  7.0282  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -121.771  14.1424  7.0282  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 1845 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -122.879  14.1424  7.0282  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -119.99  14.1424  7.0282  0.31955
protocols.relax.FastRelax: {0} CMD: min  -152.367  14.215  5.41257  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -152.367  14.215  5.41257  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -120.928  14.215  5.41257  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 1818 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -121.548  14.215  5.41257  0.55
protocols.relax.FastRelax: {0} CMD: min  -168.207  13.8972  4.19721  0.55
protocols.relax.FastRelax: {0} MRP: 0  -168.207  -168.207  13.8972  4.19721
protocols.relax.FastRelax: {0} CMD: accept_to_best  -168.207  13.8972  4.19721  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -168.207  13.8972  4.19721  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -168.207  13.8972  4.19721  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -220.926  13.8972  4.19721  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2020 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -231.741  13.8972  4.19721  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -229.83  13.8972  4.19721  0.02805
protocols.relax.FastRelax: {0} CMD: min  -266.471  13.9439  4.344  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -266.471  13.9439  4.344  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -175.826  13.9439  4.344  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2079 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -194.983  13.9439  4.344  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -190.626  13.9439  4.344  0.154
protocols.relax.FastRelax: {0} CMD: min  -230.229  14.0716  4.41987  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -230.229  14.0716  4.41987  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -195.843  14.0716  4.41987  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2305 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -196.354  14.0716  4.41987  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -193.791  14.0716  4.41987  0.31955
protocols.relax.FastRelax: {0} CMD: min  -200.472  14.0756  4.34154  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -200.472  14.0756  4.34154  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -165.01  14.0756  4.34154  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2107 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -165.404  14.0756  4.34154  0.55
protocols.relax.FastRelax: {0} CMD: min  -197.988  13.7329  4.57761  0.55
protocols.relax.FastRelax: {0} MRP: 1  -197.988  -197.988  13.7329  4.57761
protocols.relax.FastRelax: {0} CMD: accept_to_best  -197.988  13.7329  4.57761  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -197.988  13.7329  4.57761  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -197.988  13.7329  4.57761  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -252.733  13.7329  4.57761  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2475 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -266.257  13.7329  4.57761  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -263.363  13.7329  4.57761  0.02805
protocols.relax.FastRelax: {0} CMD: min  -308.773  13.6736  4.39599  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -308.773  13.6736  4.39599  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -192.398  13.6736  4.39599  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3078 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -216.386  13.6736  4.39599  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -210.863  13.6736  4.39599  0.154
protocols.relax.FastRelax: {0} CMD: min  -252.501  13.6681  4.63485  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -252.501  13.6681  4.63485  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -212.967  13.6681  4.63485  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2591 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -216.708  13.6681  4.63485  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -213.765  13.6681  4.63485  0.31955
protocols.relax.FastRelax: {0} CMD: min  -222.122  13.6979  4.66159  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -222.122  13.6979  4.66159  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -180.259  13.6979  4.66159  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2433 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -180.463  13.6979  4.66159  0.55
protocols.relax.FastRelax: {0} CMD: min  -206.507  13.8193  4.5917  0.55
protocols.relax.FastRelax: {0} MRP: 2  -206.507  -206.507  13.8193  4.5917
protocols.relax.FastRelax: {0} CMD: accept_to_best  -206.507  13.8193  4.5917  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -206.507  13.8193  4.5917  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -206.507  13.8193  4.5917  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -263.808  13.8193  4.5917  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2588 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -272.064  13.8193  4.5917  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -269.042  13.8193  4.5917  0.02805
protocols.relax.FastRelax: {0} CMD: min  -310.618  13.6553  4.37471  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -310.618  13.6553  4.37471  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -197.498  13.6553  4.37471  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2969 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -220.454  13.6553  4.37471  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -214.956  13.6553  4.37471  0.154
protocols.relax.FastRelax: {0} CMD: min  -255.319  13.579  4.56614  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -255.319  13.579  4.56614  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -213.171  13.579  4.56614  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2791 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -216.213  13.579  4.56614  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -213.034  13.579  4.56614  0.31955
protocols.relax.FastRelax: {0} CMD: min  -225.251  13.5964  4.51974  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -225.251  13.5964  4.51974  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -185.788  13.5964  4.51974  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2486 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -186.7  13.5964  4.51974  0.55
protocols.relax.FastRelax: {0} CMD: min  -207.005  13.6469  4.62267  0.55
protocols.relax.FastRelax: {0} MRP: 3  -207.005  -207.005  13.6469  4.62267
protocols.relax.FastRelax: {0} CMD: accept_to_best  -207.005  13.6469  4.62267  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -207.005  13.6469  4.62267  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -207.005  13.6469  4.62267  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -265.595  13.6469  4.62267  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2575 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -271.456  13.6469  4.62267  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -269.915  13.6469  4.62267  0.02805
protocols.relax.FastRelax: {0} CMD: min  -284.068  13.7957  4.4149  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -284.068  13.7957  4.4149  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -225.11  13.7957  4.4149  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2950 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -244.552  13.7957  4.4149  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -242.058  13.7957  4.4149  0.154
protocols.relax.FastRelax: {0} CMD: min  -257.51  13.6949  4.3993  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -257.51  13.6949  4.3993  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -225.745  13.6949  4.3993  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2740 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -226.059  13.6949  4.3993  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -223.585  13.6949  4.3993  0.31955
protocols.relax.FastRelax: {0} CMD: min  -230.476  13.6609  4.50281  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -230.476  13.6609  4.50281  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -195.809  13.6609  4.50281  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2504 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -195.843  13.6609  4.50281  0.55
protocols.relax.FastRelax: {0} CMD: min  -207.463  13.6078  4.68178  0.55
protocols.relax.FastRelax: {0} MRP: 4  -207.463  -207.463  13.6078  4.68178
protocols.relax.FastRelax: {0} CMD: accept_to_best  -207.463  13.6078  4.68178  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -207.463  13.6078  4.68178  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_27.pdb
protocols.relax.FastRelax: {0} CMD: repeat  68712.2  15.0421  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  68712.2  15.0421  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7253.26  15.0421  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3051 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  138.273  15.0421  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  168.656  15.0421  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -281.058  14.8956  2.107  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -281.058  14.8956  2.107  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -135.839  14.8956  2.107  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2882 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -167.873  14.8956  2.107  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -160.668  14.8956  2.107  0.154
protocols.relax.FastRelax: {0} CMD: min  -249.729  14.7  2.59295  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -249.729  14.7  2.59295  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -205.601  14.7  2.59295  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3053 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -207.435  14.7  2.59295  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -204.004  14.7  2.59295  0.31955
protocols.relax.FastRelax: {0} CMD: min  -215.155  14.7263  2.50867  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -215.155  14.7263  2.50867  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -170.652  14.7263  2.50867  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2810 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -171.152  14.7263  2.50867  0.55
protocols.relax.FastRelax: {0} CMD: min  -216.097  14.8055  3.3308  0.55
protocols.relax.FastRelax: {0} MRP: 0  -216.097  -216.097  14.8055  3.3308
protocols.relax.FastRelax: {0} CMD: accept_to_best  -216.097  14.8055  3.3308  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -216.097  14.8055  3.3308  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -216.097  14.8055  3.3308  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -279.445  14.8055  3.3308  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3146 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -294.262  14.8055  3.3308  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -291.686  14.8055  3.3308  0.02805
protocols.relax.FastRelax: {0} CMD: min  -349.558  14.5542  3.84442  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -349.558  14.5542  3.84442  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -207.012  14.5542  3.84442  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3258 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -223.064  14.5542  3.84442  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -215.144  14.5542  3.84442  0.154
protocols.relax.FastRelax: {0} CMD: min  -286.819  14.6651  3.78987  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -286.819  14.6651  3.78987  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -243.971  14.6651  3.78987  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2876 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -243.2  14.6651  3.78987  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -239.931  14.6651  3.78987  0.31955
protocols.relax.FastRelax: {0} CMD: min  -253.401  14.7303  3.74428  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -253.401  14.7303  3.74428  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -211.96  14.7303  3.74428  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2718 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -212.007  14.7303  3.74428  0.55
protocols.relax.FastRelax: {0} CMD: min  -232.778  14.8312  3.78632  0.55
protocols.relax.FastRelax: {0} MRP: 1  -232.778  -232.778  14.8312  3.78632
protocols.relax.FastRelax: {0} CMD: accept_to_best  -232.778  14.8312  3.78632  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -232.778  14.8312  3.78632  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -232.778  14.8312  3.78632  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -297.918  14.8312  3.78632  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3094 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -305.871  14.8312  3.78632  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -303.219  14.8312  3.78632  0.02805
protocols.relax.FastRelax: {0} CMD: min  -360.902  14.6381  3.98127  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -360.902  14.6381  3.98127  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -213.81  14.6381  3.98127  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3325 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -231.061  14.6381  3.98127  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -223.29  14.6381  3.98127  0.154
protocols.relax.FastRelax: {0} CMD: min  -289.175  14.5996  3.82627  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -289.175  14.5996  3.82627  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -244.446  14.5996  3.82627  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3112 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -245.572  14.5996  3.82627  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -242.123  14.5996  3.82627  0.31955
protocols.relax.FastRelax: {0} CMD: min  -253.626  14.6168  3.84866  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -253.626  14.6168  3.84866  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -209.722  14.6168  3.84866  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2853 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -210.092  14.6168  3.84866  0.55
protocols.relax.FastRelax: {0} CMD: min  -231.342  14.76  3.91739  0.55
protocols.relax.FastRelax: {0} MRP: 2  -231.342  -232.778  14.8312  3.78632
protocols.relax.FastRelax: {0} CMD: accept_to_best  -231.342  14.76  3.91739  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -231.342  14.76  3.91739  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -231.342  14.76  3.91739  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -294.17  14.76  3.91739  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3268 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -307.441  14.76  3.91739  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -304.402  14.76  3.91739  0.02805
protocols.relax.FastRelax: {0} CMD: min  -360.552  14.5103  3.80904  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -360.552  14.5103  3.80904  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -209.348  14.5103  3.80904  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3424 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -240.388  14.5103  3.80904  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -233.203  14.5103  3.80904  0.154
protocols.relax.FastRelax: {0} CMD: min  -298.059  14.6061  3.83813  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -298.059  14.6061  3.83813  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -251.922  14.6061  3.83813  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3179 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -252.108  14.6061  3.83813  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -248.489  14.6061  3.83813  0.31955
protocols.relax.FastRelax: {0} CMD: min  -258.293  14.6413  3.7879  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -258.293  14.6413  3.7879  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -213.013  14.6413  3.7879  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3076 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -213.622  14.6413  3.7879  0.55
protocols.relax.FastRelax: {0} CMD: min  -238.73  14.8386  3.73214  0.55
protocols.relax.FastRelax: {0} MRP: 3  -238.73  -238.73  14.8386  3.73214
protocols.relax.FastRelax: {0} CMD: accept_to_best  -238.73  14.8386  3.73214  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -238.73  14.8386  3.73214  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -238.73  14.8386  3.73214  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -302.941  14.8386  3.73214  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3353 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -315.456  14.8386  3.73214  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -312.249  14.8386  3.73214  0.02805
protocols.relax.FastRelax: {0} CMD: min  -361.684  14.547  3.8677  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -361.684  14.547  3.8677  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -219.189  14.547  3.8677  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3555 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -260.707  14.547  3.8677  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -254.719  14.547  3.8677  0.154
protocols.relax.FastRelax: {0} CMD: min  -297.433  14.5697  3.86018  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -297.433  14.5697  3.86018  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -250.617  14.5697  3.86018  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3130 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -251.346  14.5697  3.86018  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -247.697  14.5697  3.86018  0.31955
protocols.relax.FastRelax: {0} CMD: min  -264.459  14.6667  3.8091  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -264.459  14.6667  3.8091  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -222.728  14.6667  3.8091  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3072 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -223.314  14.6667  3.8091  0.55
protocols.relax.FastRelax: {0} CMD: min  -243.126  14.9698  3.46607  0.55
protocols.relax.FastRelax: {0} MRP: 4  -243.126  -243.126  14.9698  3.46607
protocols.relax.FastRelax: {0} CMD: accept_to_best  -243.126  14.9698  3.46607  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -243.126  14.9698  3.46607  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_10.pdb
protocols.relax.FastRelax: {0} CMD: repeat  73924.5  15.9907  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  73924.5  15.9907  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7045.03  15.9907  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3127 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -73.0394  15.9907  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -39.8338  15.9907  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -181.853  15.938  1.68431  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -181.853  15.938  1.68431  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -29.6029  15.938  1.68431  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2685 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -59.3378  15.938  1.68431  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -50.9655  15.938  1.68431  0.154
protocols.relax.FastRelax: {0} CMD: min  -206.458  15.9304  2.44468  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -206.458  15.9304  2.44468  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -160.359  15.9304  2.44468  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2484 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -162.572  15.9304  2.44468  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -158.928  15.9304  2.44468  0.31955
protocols.relax.FastRelax: {0} CMD: min  -191.086  15.9612  2.87551  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -191.086  15.9612  2.87551  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -148.402  15.9612  2.87551  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2470 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -148.835  15.9612  2.87551  0.55
protocols.relax.FastRelax: {0} CMD: min  -178.797  16.0375  2.8292  0.55
protocols.relax.FastRelax: {0} MRP: 0  -178.797  -178.797  16.0375  2.8292
protocols.relax.FastRelax: {0} CMD: accept_to_best  -178.797  16.0375  2.8292  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -178.797  16.0375  2.8292  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -178.797  16.0375  2.8292  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -247.63  16.0375  2.8292  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2928 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -263.013  16.0375  2.8292  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -259.497  16.0375  2.8292  0.02805
protocols.relax.FastRelax: {0} CMD: min  -317.236  16.0385  2.74345  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -317.236  16.0385  2.74345  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -186.376  16.0385  2.74345  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2888 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -206.146  16.0385  2.74345  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -199.555  16.0385  2.74345  0.154
protocols.relax.FastRelax: {0} CMD: min  -250.448  16.1157  2.84948  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -250.448  16.1157  2.84948  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -202.015  16.1157  2.84948  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2609 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -195.325  16.1157  2.84948  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -191.614  16.1157  2.84948  0.31955
protocols.relax.FastRelax: {0} CMD: min  -208.916  16.0991  2.87936  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -208.916  16.0991  2.87936  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -163.065  16.0991  2.87936  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2467 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -164.391  16.0991  2.87936  0.55
protocols.relax.FastRelax: {0} CMD: min  -198.902  16.1639  3.00207  0.55
protocols.relax.FastRelax: {0} MRP: 1  -198.902  -198.902  16.1639  3.00207
protocols.relax.FastRelax: {0} CMD: accept_to_best  -198.902  16.1639  3.00207  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -198.902  16.1639  3.00207  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -198.902  16.1639  3.00207  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -266.319  16.1639  3.00207  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2897 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -283.265  16.1639  3.00207  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -280.001  16.1639  3.00207  0.02805
protocols.relax.FastRelax: {0} CMD: min  -339.559  16.0684  3.07484  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -339.559  16.0684  3.07484  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -197.576  16.0684  3.07484  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2992 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -207.48  16.0684  3.07484  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -199.579  16.0684  3.07484  0.154
protocols.relax.FastRelax: {0} CMD: min  -261.132  16.1411  3.01936  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -261.132  16.1411  3.01936  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -211.832  16.1411  3.01936  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2780 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -213.125  16.1411  3.01936  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -209.252  16.1411  3.01936  0.31955
protocols.relax.FastRelax: {0} CMD: min  -224.649  16.1615  3.05488  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -224.649  16.1615  3.05488  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -178.91  16.1615  3.05488  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2489 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -180.189  16.1615  3.05488  0.55
protocols.relax.FastRelax: {0} CMD: min  -209.767  16.3439  2.96656  0.55
protocols.relax.FastRelax: {0} MRP: 2  -209.767  -209.767  16.3439  2.96656
protocols.relax.FastRelax: {0} CMD: accept_to_best  -209.767  16.3439  2.96656  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -209.767  16.3439  2.96656  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -209.767  16.3439  2.96656  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -276.452  16.3439  2.96656  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2890 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -287.597  16.3439  2.96656  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -285.397  16.3439  2.96656  0.02805
protocols.relax.FastRelax: {0} CMD: min  -340.24  16.1642  3.08383  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -340.24  16.1642  3.08383  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -210.385  16.1642  3.08383  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2964 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -221.88  16.1642  3.08383  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -214.309  16.1642  3.08383  0.154
protocols.relax.FastRelax: {0} CMD: min  -274.791  16.2981  3.04821  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -274.791  16.2981  3.04821  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -224.066  16.2981  3.04821  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2867 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -225.277  16.2981  3.04821  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -221.406  16.2981  3.04821  0.31955
protocols.relax.FastRelax: {0} CMD: min  -238.07  16.3115  2.99102  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -238.07  16.3115  2.99102  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -193.926  16.3115  2.99102  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2408 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -194.222  16.3115  2.99102  0.55
protocols.relax.FastRelax: {0} CMD: min  -211.108  16.2556  2.92141  0.55
protocols.relax.FastRelax: {0} MRP: 3  -211.108  -211.108  16.2556  2.92141
protocols.relax.FastRelax: {0} CMD: accept_to_best  -211.108  16.2556  2.92141  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -211.108  16.2556  2.92141  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -211.108  16.2556  2.92141  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -279.357  16.2556  2.92141  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2809 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -289.366  16.2556  2.92141  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -287.029  16.2556  2.92141  0.02805
protocols.relax.FastRelax: {0} CMD: min  -332.18  16.1262  3.04478  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -332.18  16.1262  3.04478  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -211.252  16.1262  3.04478  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2899 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -231.731  16.1262  3.04478  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -225.792  16.1262  3.04478  0.154
protocols.relax.FastRelax: {0} CMD: min  -277.218  16.1755  3.27845  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -277.218  16.1755  3.27845  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -234.061  16.1755  3.27845  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2800 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -234.456  16.1755  3.27845  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -231.103  16.1755  3.27845  0.31955
protocols.relax.FastRelax: {0} CMD: min  -238.885  16.1858  3.22448  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -238.885  16.1858  3.22448  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -191.792  16.1858  3.22448  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2645 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -192.027  16.1858  3.22448  0.55
protocols.relax.FastRelax: {0} CMD: min  -212.353  16.0946  3.23142  0.55
protocols.relax.FastRelax: {0} MRP: 4  -212.353  -212.353  16.0946  3.23142
protocols.relax.FastRelax: {0} CMD: accept_to_best  -212.353  16.0946  3.23142  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -212.353  16.0946  3.23142  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_7.pdb
protocols.relax.FastRelax: {0} CMD: repeat  75426.8  10.5855  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  75426.8  10.5855  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7084.35  10.5855  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2548 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -53.9532  10.5855  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -16.0649  10.5855  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -282.46  11.097  4.04202  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -282.46  11.097  4.04202  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -157.114  11.097  4.04202  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2290 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -174.648  11.097  4.04202  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -168.416  11.097  4.04202  0.154
protocols.relax.FastRelax: {0} CMD: min  -226.063  10.8546  3.76201  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -226.063  10.8546  3.76201  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -186.348  10.8546  3.76201  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2082 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -184.668  10.8546  3.76201  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -181.709  10.8546  3.76201  0.31955
protocols.relax.FastRelax: {0} CMD: min  -184.274  10.8666  3.78044  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -184.274  10.8666  3.78044  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -132.764  10.8666  3.78044  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2034 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -133.603  10.8666  3.78044  0.55
protocols.relax.FastRelax: {0} CMD: min  -196.021  8.8852  4.96021  0.55
protocols.relax.FastRelax: {0} MRP: 0  -196.021  -196.021  8.8852  4.96021
protocols.relax.FastRelax: {0} CMD: accept_to_best  -196.021  8.8852  4.96021  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -196.021  8.8852  4.96021  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -196.021  8.8852  4.96021  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -252.656  8.8852  4.96021  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2322 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -270.903  8.8852  4.96021  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -267.045  8.8852  4.96021  0.02805
protocols.relax.FastRelax: {0} CMD: min  -313.551  8.71815  4.91277  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -313.551  8.71815  4.91277  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -175.047  8.71815  4.91277  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2391 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -203.881  8.71815  4.91277  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -197.08  8.71815  4.91277  0.154
protocols.relax.FastRelax: {0} CMD: min  -258.833  8.63527  5.2789  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -258.833  8.63527  5.2789  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -219.421  8.63527  5.2789  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2191 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -219.779  8.63527  5.2789  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -216.716  8.63527  5.2789  0.31955
protocols.relax.FastRelax: {0} CMD: min  -220.365  8.6209  5.33214  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -220.365  8.6209  5.33214  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -170.001  8.6209  5.33214  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2174 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -170.897  8.6209  5.33214  0.55
protocols.relax.FastRelax: {0} CMD: min  -208.268  8.42289  6.22755  0.55
protocols.relax.FastRelax: {0} MRP: 1  -208.268  -208.268  8.42289  6.22755
protocols.relax.FastRelax: {0} CMD: accept_to_best  -208.268  8.42289  6.22755  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -208.268  8.42289  6.22755  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -208.268  8.42289  6.22755  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -267.248  8.42289  6.22755  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2320 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -280.487  8.42289  6.22755  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -277.227  8.42289  6.22755  0.02805
protocols.relax.FastRelax: {0} CMD: min  -322.606  8.25854  5.95543  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -322.606  8.25854  5.95543  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -148.418  8.25854  5.95543  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2596 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -181.84  8.25854  5.95543  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -173.191  8.25854  5.95543  0.154
protocols.relax.FastRelax: {0} CMD: min  -259.98  8.2874  6.62734  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -259.98  8.2874  6.62734  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -222.054  8.2874  6.62734  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2326 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -224.497  8.2874  6.62734  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -221.519  8.2874  6.62734  0.31955
protocols.relax.FastRelax: {0} CMD: min  -229.723  8.38293  6.80975  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -229.723  8.38293  6.80975  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -191.277  8.38293  6.80975  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2222 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -191.547  8.38293  6.80975  0.55
protocols.relax.FastRelax: {0} CMD: min  -211.633  8.16745  7.30364  0.55
protocols.relax.FastRelax: {0} MRP: 2  -211.633  -211.633  8.16745  7.30364
protocols.relax.FastRelax: {0} CMD: accept_to_best  -211.633  8.16745  7.30364  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -211.633  8.16745  7.30364  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -211.633  8.16745  7.30364  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -269.477  8.16745  7.30364  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2193 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -281.908  8.16745  7.30364  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -279.328  8.16745  7.30364  0.02805
protocols.relax.FastRelax: {0} CMD: min  -329.369  7.94915  6.84744  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -329.369  7.94915  6.84744  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -200.591  7.94915  6.84744  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2507 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -219.521  7.94915  6.84744  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -212.759  7.94915  6.84744  0.154
protocols.relax.FastRelax: {0} CMD: min  -263.994  8.18562  6.76021  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -263.994  8.18562  6.76021  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -223.912  8.18562  6.76021  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2201 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -225.288  8.18562  6.76021  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -222.227  8.18562  6.76021  0.31955
protocols.relax.FastRelax: {0} CMD: min  -233.467  8.25558  6.90629  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -233.467  8.25558  6.90629  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -194.303  8.25558  6.90629  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 1971 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -194.382  8.25558  6.90629  0.55
protocols.relax.FastRelax: {0} CMD: min  -215.114  8.52401  6.57814  0.55
protocols.relax.FastRelax: {0} MRP: 3  -215.114  -215.114  8.52401  6.57814
protocols.relax.FastRelax: {0} CMD: accept_to_best  -215.114  8.52401  6.57814  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -215.114  8.52401  6.57814  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -215.114  8.52401  6.57814  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -273.699  8.52401  6.57814  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2210 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -283.992  8.52401  6.57814  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -281.62  8.52401  6.57814  0.02805
protocols.relax.FastRelax: {0} CMD: min  -334.688  8.34524  6.11139  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -334.688  8.34524  6.11139  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -193.526  8.34524  6.11139  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2439 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -212.144  8.34524  6.11139  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -204.331  8.34524  6.11139  0.154
protocols.relax.FastRelax: {0} CMD: min  -274.828  8.62587  6.28019  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -274.828  8.62587  6.28019  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -230.445  8.62587  6.28019  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2161 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -231.32  8.62587  6.28019  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -227.936  8.62587  6.28019  0.31955
protocols.relax.FastRelax: {0} CMD: min  -240.276  8.70572  6.4922  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -240.276  8.70572  6.4922  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -199.793  8.70572  6.4922  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 1977 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -199.723  8.70572  6.4922  0.55
protocols.relax.FastRelax: {0} CMD: min  -217.331  8.71157  6.50638  0.55
protocols.relax.FastRelax: {0} MRP: 4  -217.331  -217.331  8.71157  6.50638
protocols.relax.FastRelax: {0} CMD: accept_to_best  -217.331  8.71157  6.50638  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -217.331  8.71157  6.50638  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_32.pdb
protocols.relax.FastRelax: {0} CMD: repeat  67037.7  14.1885  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  67037.7  14.1885  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  6711.76  14.1885  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2114 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -110.793  14.1885  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -88.6694  14.1885  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -305.903  14.2734  4.39239  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -305.903  14.2734  4.39239  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -181.417  14.2734  4.39239  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2454 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -203.791  14.2734  4.39239  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -196.793  14.2734  4.39239  0.154
protocols.relax.FastRelax: {0} CMD: min  -252.393  14.2969  4.45255  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -252.393  14.2969  4.45255  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -207.987  14.2969  4.45255  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2326 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -209.207  14.2969  4.45255  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -205.8  14.2969  4.45255  0.31955
protocols.relax.FastRelax: {0} CMD: min  -221.303  14.3685  4.63274  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -221.303  14.3685  4.63274  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -180.813  14.3685  4.63274  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2187 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -181.772  14.3685  4.63274  0.55
protocols.relax.FastRelax: {0} CMD: min  -243.609  14.127  5.33097  0.55
protocols.relax.FastRelax: {0} MRP: 0  -243.609  -243.609  14.127  5.33097
protocols.relax.FastRelax: {0} CMD: accept_to_best  -243.609  14.127  5.33097  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -243.609  14.127  5.33097  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -243.609  14.127  5.33097  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -300.761  14.127  5.33097  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2867 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -315.988  14.127  5.33097  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -313.124  14.127  5.33097  0.02805
protocols.relax.FastRelax: {0} CMD: min  -368.894  14.1668  5.52214  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -368.894  14.1668  5.52214  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -242.519  14.1668  5.52214  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3533 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -262.227  14.1668  5.52214  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -255.87  14.1668  5.52214  0.154
protocols.relax.FastRelax: {0} CMD: min  -307.736  14.2507  5.22913  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -307.736  14.2507  5.22913  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -266.925  14.2507  5.22913  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3163 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -267.33  14.2507  5.22913  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -264.157  14.2507  5.22913  0.31955
protocols.relax.FastRelax: {0} CMD: min  -273.139  14.2071  5.11787  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -273.139  14.2071  5.11787  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -231.966  14.2071  5.11787  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2719 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -232.134  14.2071  5.11787  0.55
protocols.relax.FastRelax: {0} CMD: min  -258.132  14.3126  5.12923  0.55
protocols.relax.FastRelax: {0} MRP: 1  -258.132  -258.132  14.3126  5.12923
protocols.relax.FastRelax: {0} CMD: accept_to_best  -258.132  14.3126  5.12923  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -258.132  14.3126  5.12923  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -258.132  14.3126  5.12923  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -320.766  14.3126  5.12923  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3338 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -330.853  14.3126  5.12923  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -327.786  14.3126  5.12923  0.02805
protocols.relax.FastRelax: {0} CMD: min  -379.363  14.29  5.31101  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -379.363  14.29  5.31101  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -251.132  14.29  5.31101  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3466 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -274.812  14.29  5.31101  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -267.973  14.29  5.31101  0.154
protocols.relax.FastRelax: {0} CMD: min  -319.183  14.3289  5.29154  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -319.183  14.3289  5.29154  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -276.998  14.3289  5.29154  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3100 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -277.218  14.3289  5.29154  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -273.952  14.3289  5.29154  0.31955
protocols.relax.FastRelax: {0} CMD: min  -283.625  14.2843  5.1255  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -283.625  14.2843  5.1255  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -240.656  14.2843  5.1255  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2690 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -241.153  14.2843  5.1255  0.55
protocols.relax.FastRelax: {0} CMD: min  -265.386  14.3578  5.18866  0.55
protocols.relax.FastRelax: {0} MRP: 2  -265.386  -265.386  14.3578  5.18866
protocols.relax.FastRelax: {0} CMD: accept_to_best  -265.386  14.3578  5.18866  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -265.386  14.3578  5.18866  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -265.386  14.3578  5.18866  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -328.556  14.3578  5.18866  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3116 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -337.566  14.3578  5.18866  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -335.835  14.3578  5.18866  0.02805
protocols.relax.FastRelax: {0} CMD: min  -385.456  14.2624  5.3635  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -385.456  14.2624  5.3635  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -266.518  14.2624  5.3635  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3490 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -287.107  14.2624  5.3635  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -280.693  14.2624  5.3635  0.154
protocols.relax.FastRelax: {0} CMD: min  -327.133  14.2899  5.29204  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -327.133  14.2899  5.29204  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -284.191  14.2899  5.29204  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2910 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -284.306  14.2899  5.29204  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -280.937  14.2899  5.29204  0.31955
protocols.relax.FastRelax: {0} CMD: min  -290.422  14.2643  5.20426  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -290.422  14.2643  5.20426  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -245.438  14.2643  5.20426  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2845 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -245.583  14.2643  5.20426  0.55
protocols.relax.FastRelax: {0} CMD: min  -268.484  14.3221  5.24766  0.55
protocols.relax.FastRelax: {0} MRP: 3  -268.484  -268.484  14.3221  5.24766
protocols.relax.FastRelax: {0} CMD: accept_to_best  -268.484  14.3221  5.24766  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -268.484  14.3221  5.24766  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -268.484  14.3221  5.24766  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -332.336  14.3221  5.24766  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3092 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -341.346  14.3221  5.24766  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -339.485  14.3221  5.24766  0.02805
protocols.relax.FastRelax: {0} CMD: min  -389.108  14.2702  5.21025  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -389.108  14.2702  5.21025  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -259.816  14.2702  5.21025  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3467 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -277.545  14.2702  5.21025  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -270.186  14.2702  5.21025  0.154
protocols.relax.FastRelax: {0} CMD: min  -326.019  14.2591  5.12981  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -326.019  14.2591  5.12981  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -279.188  14.2591  5.12981  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3136 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -279.435  14.2591  5.12981  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -275.776  14.2591  5.12981  0.31955
protocols.relax.FastRelax: {0} CMD: min  -292.589  14.2746  5.16332  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -292.589  14.2746  5.16332  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -250.714  14.2746  5.16332  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2841 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -251.003  14.2746  5.16332  0.55
protocols.relax.FastRelax: {0} CMD: min  -265.732  14.2981  5.14067  0.55
protocols.relax.FastRelax: {0} MRP: 4  -265.732  -268.484  14.3221  5.24766
protocols.relax.FastRelax: {0} CMD: accept_to_best  -265.732  14.2981  5.14067  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -265.732  14.2981  5.14067  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_31.pdb
protocols.relax.FastRelax: {0} CMD: repeat  71450.5  14.2714  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  71450.5  14.2714  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7224.05  14.2714  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2646 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -111.645  14.2714  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -98.2092  14.2714  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -268.062  13.6428  1.95705  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -268.062  13.6428  1.95705  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -128.85  13.6428  1.95705  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2575 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -148.76  13.6428  1.95705  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -140.59  13.6428  1.95705  0.154
protocols.relax.FastRelax: {0} CMD: min  -222.675  13.7182  1.99888  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -222.675  13.7182  1.99888  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -173.197  13.7182  1.99888  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2472 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -175.548  13.7182  1.99888  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -171.732  13.7182  1.99888  0.31955
protocols.relax.FastRelax: {0} CMD: min  -185.472  13.7853  1.92449  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -185.472  13.7853  1.92449  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -137.129  13.7853  1.92449  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2234 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -137.197  13.7853  1.92449  0.55
protocols.relax.FastRelax: {0} CMD: min  -176.295  13.8996  2.5182  0.55
protocols.relax.FastRelax: {0} MRP: 0  -176.295  -176.295  13.8996  2.5182
protocols.relax.FastRelax: {0} CMD: accept_to_best  -176.295  13.8996  2.5182  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -176.295  13.8996  2.5182  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -176.295  13.8996  2.5182  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -243.914  13.8996  2.5182  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2757 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -251.753  13.8996  2.5182  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -250.239  13.8996  2.5182  0.02805
protocols.relax.FastRelax: {0} CMD: min  -309.441  13.6792  2.89621  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -309.441  13.6792  2.89621  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -175.684  13.6792  2.89621  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2621 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -188.858  13.6792  2.89621  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -181.251  13.6792  2.89621  0.154
protocols.relax.FastRelax: {0} CMD: min  -246.056  13.7763  2.75175  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -246.056  13.7763  2.75175  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -197.92  13.7763  2.75175  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2493 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -199.614  13.7763  2.75175  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -195.945  13.7763  2.75175  0.31955
protocols.relax.FastRelax: {0} CMD: min  -208.263  13.8204  2.7636  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -208.263  13.8204  2.7636  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -160.055  13.8204  2.7636  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2445 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -160.278  13.8204  2.7636  0.55
protocols.relax.FastRelax: {0} CMD: min  -188.494  13.8543  3.07209  0.55
protocols.relax.FastRelax: {0} MRP: 1  -188.494  -188.494  13.8543  3.07209
protocols.relax.FastRelax: {0} CMD: accept_to_best  -188.494  13.8543  3.07209  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -188.494  13.8543  3.07209  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -188.494  13.8543  3.07209  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -256.776  13.8543  3.07209  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2794 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -262.928  13.8543  3.07209  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -261.56  13.8543  3.07209  0.02805
protocols.relax.FastRelax: {0} CMD: min  -317.93  13.6532  3.07772  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -317.93  13.6532  3.07772  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -195.364  13.6532  3.07772  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2729 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -206.191  13.6532  3.07772  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -199.035  13.6532  3.07772  0.154
protocols.relax.FastRelax: {0} CMD: min  -253.183  13.7586  3.11302  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -253.183  13.7586  3.11302  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -206.634  13.7586  3.11302  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2472 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -207.752  13.7586  3.11302  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -204.087  13.7586  3.11302  0.31955
protocols.relax.FastRelax: {0} CMD: min  -213.704  13.7888  3.07809  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -213.704  13.7888  3.07809  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -164.695  13.7888  3.07809  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2412 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -163.167  13.7888  3.07809  0.55
protocols.relax.FastRelax: {0} CMD: min  -193.969  13.9408  3.7221  0.55
protocols.relax.FastRelax: {0} MRP: 2  -193.969  -193.969  13.9408  3.7221
protocols.relax.FastRelax: {0} CMD: accept_to_best  -193.969  13.9408  3.7221  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -193.969  13.9408  3.7221  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -193.969  13.9408  3.7221  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -261.014  13.9408  3.7221  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2406 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -267.712  13.9408  3.7221  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -266.201  13.9408  3.7221  0.02805
protocols.relax.FastRelax: {0} CMD: min  -323.184  13.7605  3.80267  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -323.184  13.7605  3.80267  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -202.298  13.7605  3.80267  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2782 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -216.903  13.7605  3.80267  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -210.195  13.7605  3.80267  0.154
protocols.relax.FastRelax: {0} CMD: min  -251.619  13.9327  3.72318  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -251.619  13.9327  3.72318  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -196.974  13.9327  3.72318  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2540 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -201.434  13.9327  3.72318  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -197.382  13.9327  3.72318  0.31955
protocols.relax.FastRelax: {0} CMD: min  -221.445  13.9419  3.64206  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -221.445  13.9419  3.64206  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -179.882  13.9419  3.64206  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2304 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -180.437  13.9419  3.64206  0.55
protocols.relax.FastRelax: {0} CMD: min  -201.589  14.0527  4.53561  0.55
protocols.relax.FastRelax: {0} MRP: 3  -201.589  -201.589  14.0527  4.53561
protocols.relax.FastRelax: {0} CMD: accept_to_best  -201.589  14.0527  4.53561  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -201.589  14.0527  4.53561  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -201.589  14.0527  4.53561  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -269.652  14.0527  4.53561  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2426 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -275.667  14.0527  4.53561  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -274.196  14.0527  4.53561  0.02805
protocols.relax.FastRelax: {0} CMD: min  -309.717  13.8549  4.51584  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -309.717  13.8549  4.51584  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -222.182  13.8549  4.51584  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2806 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -236.078  13.8549  4.51584  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -231.608  13.8549  4.51584  0.154
protocols.relax.FastRelax: {0} CMD: min  -257.347  13.9512  4.37097  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -257.347  13.9512  4.37097  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -215.239  13.9512  4.37097  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2556 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -216.489  13.9512  4.37097  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -213.276  13.9512  4.37097  0.31955
protocols.relax.FastRelax: {0} CMD: min  -226.863  14.0273  4.43022  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -226.863  14.0273  4.43022  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -185.381  14.0273  4.43022  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2253 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -185.927  14.0273  4.43022  0.55
protocols.relax.FastRelax: {0} CMD: min  -201.477  14.0517  4.57299  0.55
protocols.relax.FastRelax: {0} MRP: 4  -201.477  -201.589  14.0527  4.53561
protocols.relax.FastRelax: {0} CMD: accept_to_best  -201.477  14.0517  4.57299  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -201.477  14.0517  4.57299  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_35.pdb
protocols.relax.FastRelax: {0} CMD: repeat  68571.6  14.7333  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  68571.6  14.7333  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7354.49  14.7333  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3067 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  104.879  14.7333  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  123.069  14.7333  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -268.952  14.7822  1.69236  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -268.952  14.7822  1.69236  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -138.698  14.7822  1.69236  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3198 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -165.198  14.7822  1.69236  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -158.559  14.7822  1.69236  0.154
protocols.relax.FastRelax: {0} CMD: min  -224.674  14.8213  2.03197  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -224.674  14.8213  2.03197  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -181.222  14.8213  2.03197  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2924 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -182.446  14.8213  2.03197  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -179.123  14.8213  2.03197  0.31955
protocols.relax.FastRelax: {0} CMD: min  -200.915  14.794  1.97823  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -200.915  14.794  1.97823  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -161.871  14.794  1.97823  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2756 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -162.251  14.794  1.97823  0.55
protocols.relax.FastRelax: {0} CMD: min  -193.957  14.8068  2.18527  0.55
protocols.relax.FastRelax: {0} MRP: 0  -193.957  -193.957  14.8068  2.18527
protocols.relax.FastRelax: {0} CMD: accept_to_best  -193.957  14.8068  2.18527  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -193.957  14.8068  2.18527  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -193.957  14.8068  2.18527  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -255.702  14.8068  2.18527  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3055 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -269.448  14.8068  2.18527  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -267.37  14.8068  2.18527  0.02805
protocols.relax.FastRelax: {0} CMD: min  -320.793  14.6875  2.15582  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -320.793  14.6875  2.15582  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -193.152  14.6875  2.15582  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3279 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -209.768  14.6875  2.15582  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -202.46  14.6875  2.15582  0.154
protocols.relax.FastRelax: {0} CMD: min  -260.579  14.7616  2.17974  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -260.579  14.7616  2.17974  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -215.201  14.7616  2.17974  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2854 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -215.645  14.7616  2.17974  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -212.064  14.7616  2.17974  0.31955
protocols.relax.FastRelax: {0} CMD: min  -218.888  14.7759  2.10438  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -218.888  14.7759  2.10438  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -168.254  14.7759  2.10438  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2669 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -169.694  14.7759  2.10438  0.55
protocols.relax.FastRelax: {0} CMD: min  -212.153  14.7521  2.16304  0.55
protocols.relax.FastRelax: {0} MRP: 1  -212.153  -212.153  14.7521  2.16304
protocols.relax.FastRelax: {0} CMD: accept_to_best  -212.153  14.7521  2.16304  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -212.153  14.7521  2.16304  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -212.153  14.7521  2.16304  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -273.163  14.7521  2.16304  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3130 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -280.324  14.7521  2.16304  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -278.93  14.7521  2.16304  0.02805
protocols.relax.FastRelax: {0} CMD: min  -323.766  14.628  2.21122  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -323.766  14.628  2.21122  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -201.508  14.628  2.21122  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3361 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -218.794  14.628  2.21122  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -211.867  14.628  2.21122  0.154
protocols.relax.FastRelax: {0} CMD: min  -270.12  14.7128  2.08371  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -270.12  14.7128  2.08371  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -226.173  14.7128  2.08371  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3021 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -227.279  14.7128  2.08371  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -223.891  14.7128  2.08371  0.31955
protocols.relax.FastRelax: {0} CMD: min  -237.026  14.7601  2.04741  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -237.026  14.7601  2.04741  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -196.071  14.7601  2.04741  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2975 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -196.256  14.7601  2.04741  0.55
protocols.relax.FastRelax: {0} CMD: min  -213.092  14.8343  2.10911  0.55
protocols.relax.FastRelax: {0} MRP: 2  -213.092  -213.092  14.8343  2.10911
protocols.relax.FastRelax: {0} CMD: accept_to_best  -213.092  14.8343  2.10911  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -213.092  14.8343  2.10911  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -213.092  14.8343  2.10911  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -274.305  14.8343  2.10911  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3296 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -283.074  14.8343  2.10911  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -281.249  14.8343  2.10911  0.02805
protocols.relax.FastRelax: {0} CMD: min  -331.856  14.5949  2.22541  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -331.856  14.5949  2.22541  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -199.731  14.5949  2.22541  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3361 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -219.38  14.5949  2.22541  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -212.064  14.5949  2.22541  0.154
protocols.relax.FastRelax: {0} CMD: min  -274.934  14.7161  2.03962  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -274.934  14.7161  2.03962  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -231.279  14.7161  2.03962  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3047 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -232.751  14.7161  2.03962  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -229.378  14.7161  2.03962  0.31955
protocols.relax.FastRelax: {0} CMD: min  -236.934  14.7597  2.00726  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -236.934  14.7597  2.00726  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -188.963  14.7597  2.00726  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3006 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -189.208  14.7597  2.00726  0.55
protocols.relax.FastRelax: {0} CMD: min  -218.614  14.8105  2.09881  0.55
protocols.relax.FastRelax: {0} MRP: 3  -218.614  -218.614  14.8105  2.09881
protocols.relax.FastRelax: {0} CMD: accept_to_best  -218.614  14.8105  2.09881  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -218.614  14.8105  2.09881  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -218.614  14.8105  2.09881  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -279.256  14.8105  2.09881  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3309 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -291.181  14.8105  2.09881  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -288.5  14.8105  2.09881  0.02805
protocols.relax.FastRelax: {0} CMD: min  -343.79  14.6634  2.15718  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -343.79  14.6634  2.15718  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -223.111  14.6634  2.15718  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3296 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -239.063  14.6634  2.15718  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -232.512  14.6634  2.15718  0.154
protocols.relax.FastRelax: {0} CMD: min  -282.481  14.745  2.10673  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -282.481  14.745  2.10673  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -237.653  14.745  2.10673  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3186 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -238.397  14.745  2.10673  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -234.934  14.745  2.10673  0.31955
protocols.relax.FastRelax: {0} CMD: min  -247.818  14.7797  2.09102  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -247.818  14.7797  2.09102  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -204.956  14.7797  2.09102  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3172 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -205.072  14.7797  2.09102  0.55
protocols.relax.FastRelax: {0} CMD: min  -225.605  14.8462  2.14752  0.55
protocols.relax.FastRelax: {0} MRP: 4  -225.605  -225.605  14.8462  2.14752
protocols.relax.FastRelax: {0} CMD: accept_to_best  -225.605  14.8462  2.14752  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -225.605  14.8462  2.14752  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_18.pdb
protocols.relax.FastRelax: {0} CMD: repeat  69485.4  13.1372  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  69485.4  13.1372  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7377.92  13.1372  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2920 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  165.195  13.1372  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  191.329  13.1372  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -174.9  12.8859  5.81024  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -174.9  12.8859  5.81024  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -17.765  12.8859  5.81024  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2380 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -65.2704  12.8859  5.81024  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -58.5352  12.8859  5.81024  0.154
protocols.relax.FastRelax: {0} CMD: min  -167.734  12.8039  4.68357  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -167.734  12.8039  4.68357  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -131.216  12.8039  4.68357  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2273 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -137.239  12.8039  4.68357  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -134.628  12.8039  4.68357  0.31955
protocols.relax.FastRelax: {0} CMD: min  -144.77  12.9498  5.22741  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -144.77  12.9498  5.22741  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -106.891  12.9498  5.22741  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2206 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -107.339  12.9498  5.22741  0.55
protocols.relax.FastRelax: {0} CMD: min  -161.433  12.867  6.50875  0.55
protocols.relax.FastRelax: {0} MRP: 0  -161.433  -161.433  12.867  6.50875
protocols.relax.FastRelax: {0} CMD: accept_to_best  -161.433  12.867  6.50875  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -161.433  12.867  6.50875  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -161.433  12.867  6.50875  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -217.503  12.867  6.50875  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2277 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -227.6  12.867  6.50875  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -224.18  12.867  6.50875  0.02805
protocols.relax.FastRelax: {0} CMD: min  -260.051  12.7698  6.66708  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -260.051  12.7698  6.66708  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -152.762  12.7698  6.66708  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2628 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -184.3  12.7698  6.66708  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -179.663  12.7698  6.66708  0.154
protocols.relax.FastRelax: {0} CMD: min  -214.039  12.7854  7.03649  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -214.039  12.7854  7.03649  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -178.068  12.7854  7.03649  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2443 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -179.278  12.7854  7.03649  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -176.481  12.7854  7.03649  0.31955
protocols.relax.FastRelax: {0} CMD: min  -189.9  12.9271  6.99286  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -189.9  12.9271  6.99286  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -153.55  12.9271  6.99286  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2350 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -153.233  12.9271  6.99286  0.55
protocols.relax.FastRelax: {0} CMD: min  -180.098  12.7935  7.2075  0.55
protocols.relax.FastRelax: {0} MRP: 1  -180.098  -180.098  12.7935  7.2075
protocols.relax.FastRelax: {0} CMD: accept_to_best  -180.098  12.7935  7.2075  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -180.098  12.7935  7.2075  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -180.098  12.7935  7.2075  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -239.75  12.7935  7.2075  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2394 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -246.977  12.7935  7.2075  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -244.755  12.7935  7.2075  0.02805
protocols.relax.FastRelax: {0} CMD: min  -276.859  12.5103  6.75041  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -276.859  12.5103  6.75041  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -178.394  12.5103  6.75041  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2523 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -203.636  12.5103  6.75041  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -199.427  12.5103  6.75041  0.154
protocols.relax.FastRelax: {0} CMD: min  -226.352  12.7882  6.99479  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -226.352  12.7882  6.99479  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -191.017  12.7882  6.99479  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2435 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -192.074  12.7882  6.99479  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -189.423  12.7882  6.99479  0.31955
protocols.relax.FastRelax: {0} CMD: min  -198.463  12.8066  7.0185  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -198.463  12.8066  7.0185  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -162.153  12.8066  7.0185  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2343 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -162.613  12.8066  7.0185  0.55
protocols.relax.FastRelax: {0} CMD: min  -185.943  12.8059  7.13526  0.55
protocols.relax.FastRelax: {0} MRP: 2  -185.943  -185.943  12.8059  7.13526
protocols.relax.FastRelax: {0} CMD: accept_to_best  -185.943  12.8059  7.13526  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -185.943  12.8059  7.13526  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -185.943  12.8059  7.13526  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -244.093  12.8059  7.13526  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2359 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -253.014  12.8059  7.13526  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -251.314  12.8059  7.13526  0.02805
protocols.relax.FastRelax: {0} CMD: min  -283.212  12.3093  6.45187  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -283.212  12.3093  6.45187  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -188.953  12.3093  6.45187  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2334 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -205.807  12.3093  6.45187  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -200.753  12.3093  6.45187  0.154
protocols.relax.FastRelax: {0} CMD: min  -238.13  12.4486  7.03989  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -238.13  12.4486  7.03989  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -202.715  12.4486  7.03989  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2282 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -204.106  12.4486  7.03989  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -201.271  12.4486  7.03989  0.31955
protocols.relax.FastRelax: {0} CMD: min  -210.565  12.5669  7.35772  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -210.565  12.5669  7.35772  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -172.113  12.5669  7.35772  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2194 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -172.253  12.5669  7.35772  0.55
protocols.relax.FastRelax: {0} CMD: min  -192.344  12.5558  7.72481  0.55
protocols.relax.FastRelax: {0} MRP: 3  -192.344  -192.344  12.5558  7.72481
protocols.relax.FastRelax: {0} CMD: accept_to_best  -192.344  12.5558  7.72481  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -192.344  12.5558  7.72481  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -192.344  12.5558  7.72481  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -251.389  12.5558  7.72481  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2444 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -258.328  12.5558  7.72481  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -257.036  12.5558  7.72481  0.02805
protocols.relax.FastRelax: {0} CMD: min  -288.29  12.1816  6.71044  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -288.29  12.1816  6.71044  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -193.234  12.1816  6.71044  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2349 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -206.827  12.1816  6.71044  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -201.394  12.1816  6.71044  0.154
protocols.relax.FastRelax: {0} CMD: min  -243.498  12.354  7.2068  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -243.498  12.354  7.2068  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -207.289  12.354  7.2068  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2342 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -207.671  12.354  7.2068  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -204.837  12.354  7.2068  0.31955
protocols.relax.FastRelax: {0} CMD: min  -215.573  12.4236  7.21302  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -215.573  12.4236  7.21302  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -179.002  12.4236  7.21302  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2277 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -179.036  12.4236  7.21302  0.55
protocols.relax.FastRelax: {0} CMD: min  -192.461  12.5263  7.571  0.55
protocols.relax.FastRelax: {0} MRP: 4  -192.461  -192.461  12.5263  7.571
protocols.relax.FastRelax: {0} CMD: accept_to_best  -192.461  12.5263  7.571  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -192.461  12.5263  7.571  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_12.pdb
protocols.relax.FastRelax: {0} CMD: repeat  72327.9  17.3789  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  72327.9  17.3789  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7061.96  17.3789  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2643 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  211.096  17.3789  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  254.266  17.3789  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -237.429  17.4866  11.7011  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -237.429  17.4866  11.7011  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -106.949  17.4866  11.7011  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2518 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -140.684  17.4866  11.7011  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -135.099  17.4866  11.7011  0.154
protocols.relax.FastRelax: {0} CMD: min  -193.663  16.7675  10.9569  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -193.663  16.7675  10.9569  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -150.377  16.7675  10.9569  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2143 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -156.284  16.7675  10.9569  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -153.2  16.7675  10.9569  0.31955
protocols.relax.FastRelax: {0} CMD: min  -165.42  16.9535  11.2148  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -165.42  16.9535  11.2148  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -123.22  16.9535  11.2148  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2033 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -124.881  16.9535  11.2148  0.55
protocols.relax.FastRelax: {0} CMD: min  -177.836  15.7377  11.3545  0.55
protocols.relax.FastRelax: {0} MRP: 0  -177.836  -177.836  15.7377  11.3545
protocols.relax.FastRelax: {0} CMD: accept_to_best  -177.836  15.7377  11.3545  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -177.836  15.7377  11.3545  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -177.836  15.7377  11.3545  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -231.588  15.7377  11.3545  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2279 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -244.24  15.7377  11.3545  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -242.009  15.7377  11.3545  0.02805
protocols.relax.FastRelax: {0} CMD: min  -273.355  15.4007  11.1162  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -273.355  15.4007  11.1162  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -196.76  15.4007  11.1162  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2222 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -206.775  15.4007  11.1162  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -202.686  15.4007  11.1162  0.154
protocols.relax.FastRelax: {0} CMD: min  -231.048  15.4422  11.4453  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -231.048  15.4422  11.4453  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -198.719  15.4422  11.4453  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2171 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -199.447  15.4422  11.4453  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -196.911  15.4422  11.4453  0.31955
protocols.relax.FastRelax: {0} CMD: min  -204.702  15.5564  11.2835  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -204.702  15.5564  11.2835  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -170.036  15.5564  11.2835  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2100 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -168.329  15.5564  11.2835  0.55
protocols.relax.FastRelax: {0} CMD: min  -191.983  15.4973  10.5114  0.55
protocols.relax.FastRelax: {0} MRP: 1  -191.983  -191.983  15.4973  10.5114
protocols.relax.FastRelax: {0} CMD: accept_to_best  -191.983  15.4973  10.5114  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -191.983  15.4973  10.5114  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -191.983  15.4973  10.5114  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -246.632  15.4973  10.5114  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2198 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -253.809  15.4973  10.5114  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -252.39  15.4973  10.5114  0.02805
protocols.relax.FastRelax: {0} CMD: min  -273.727  15.4485  10.6159  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -273.727  15.4485  10.6159  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -194.243  15.4485  10.6159  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2308 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -214.825  15.4485  10.6159  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -211.188  15.4485  10.6159  0.154
protocols.relax.FastRelax: {0} CMD: min  -235.428  15.462  10.4696  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -235.428  15.462  10.4696  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -204.813  15.462  10.4696  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2286 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -204.342  15.462  10.4696  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -201.979  15.462  10.4696  0.31955
protocols.relax.FastRelax: {0} CMD: min  -206.908  15.4839  10.5945  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -206.908  15.4839  10.5945  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -171.287  15.4839  10.5945  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2140 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -171.229  15.4839  10.5945  0.55
protocols.relax.FastRelax: {0} CMD: min  -194.019  15.2708  10.758  0.55
protocols.relax.FastRelax: {0} MRP: 2  -194.019  -194.019  15.2708  10.758
protocols.relax.FastRelax: {0} CMD: accept_to_best  -194.019  15.2708  10.758  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -194.019  15.2708  10.758  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -194.019  15.2708  10.758  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -248.163  15.2708  10.758  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2321 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -255.198  15.2708  10.758  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -251.364  15.2708  10.758  0.02805
protocols.relax.FastRelax: {0} CMD: min  -280.832  14.6676  10.99  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -280.832  14.6676  10.99  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -171.423  14.6676  10.99  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2318 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -207.264  14.6676  10.99  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -202.644  14.6676  10.99  0.154
protocols.relax.FastRelax: {0} CMD: min  -237.511  14.8942  10.8204  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -237.511  14.8942  10.8204  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -202.186  14.8942  10.8204  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2234 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -202.782  14.8942  10.8204  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -200.014  14.8942  10.8204  0.31955
protocols.relax.FastRelax: {0} CMD: min  -212.453  14.8595  10.7512  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -212.453  14.8595  10.7512  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -176.652  14.8595  10.7512  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2169 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -177.159  14.8595  10.7512  0.55
protocols.relax.FastRelax: {0} CMD: min  -197.851  14.8033  11.1758  0.55
protocols.relax.FastRelax: {0} MRP: 3  -197.851  -197.851  14.8033  11.1758
protocols.relax.FastRelax: {0} CMD: accept_to_best  -197.851  14.8033  11.1758  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -197.851  14.8033  11.1758  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -197.851  14.8033  11.1758  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -256.912  14.8033  11.1758  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2318 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -268.98  14.8033  11.1758  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -266.736  14.8033  11.1758  0.02805
protocols.relax.FastRelax: {0} CMD: min  -310.923  14.4135  11.2091  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -310.923  14.4135  11.2091  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -198.206  14.4135  11.2091  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2569 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -221.453  14.4135  11.2091  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -215.639  14.4135  11.2091  0.154
protocols.relax.FastRelax: {0} CMD: min  -259.307  14.4706  11.4887  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -259.307  14.4706  11.4887  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -217.557  14.4706  11.4887  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2257 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -218.587  14.4706  11.4887  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -215.43  14.4706  11.4887  0.31955
protocols.relax.FastRelax: {0} CMD: min  -222.355  14.615  11.5639  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -222.355  14.615  11.5639  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -178.638  14.615  11.5639  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2240 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -178.233  14.615  11.5639  0.55
protocols.relax.FastRelax: {0} CMD: min  -203.801  14.6428  11.5058  0.55
protocols.relax.FastRelax: {0} MRP: 4  -203.801  -203.801  14.6428  11.5058
protocols.relax.FastRelax: {0} CMD: accept_to_best  -203.801  14.6428  11.5058  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -203.801  14.6428  11.5058  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_21.pdb
protocols.relax.FastRelax: {0} CMD: repeat  69883.3  16.3861  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  69883.3  16.3861  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  6739  16.3861  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3213 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -78.1262  16.3861  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -48.9869  16.3861  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -264.773  16.0205  2.37607  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -264.773  16.0205  2.37607  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -140.72  16.0205  2.37607  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3100 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -162.257  16.0205  2.37607  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -156.003  16.0205  2.37607  0.154
protocols.relax.FastRelax: {0} CMD: min  -221.36  16.2707  2.53388  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -221.36  16.2707  2.53388  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -184.708  16.2707  2.53388  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2802 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -187.439  16.2707  2.53388  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -184.553  16.2707  2.53388  0.31955
protocols.relax.FastRelax: {0} CMD: min  -193.66  16.3073  2.44415  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -193.66  16.3073  2.44415  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -155.329  16.3073  2.44415  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2613 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -156.64  16.3073  2.44415  0.55
protocols.relax.FastRelax: {0} CMD: min  -192.059  16.4249  2.85141  0.55
protocols.relax.FastRelax: {0} MRP: 0  -192.059  -192.059  16.4249  2.85141
protocols.relax.FastRelax: {0} CMD: accept_to_best  -192.059  16.4249  2.85141  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -192.059  16.4249  2.85141  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -192.059  16.4249  2.85141  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -247.53  16.4249  2.85141  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3117 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -259.384  16.4249  2.85141  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -257.286  16.4249  2.85141  0.02805
protocols.relax.FastRelax: {0} CMD: min  -294.722  16.3222  2.78721  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -294.722  16.3222  2.78721  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -191.275  16.3222  2.78721  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3209 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -218.055  16.3222  2.78721  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -212.974  16.3222  2.78721  0.154
protocols.relax.FastRelax: {0} CMD: min  -253.867  16.3358  2.7678  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -253.867  16.3358  2.7678  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -216.702  16.3358  2.7678  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2895 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -217.905  16.3358  2.7678  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -215.051  16.3358  2.7678  0.31955
protocols.relax.FastRelax: {0} CMD: min  -222.411  16.3895  2.79836  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -222.411  16.3895  2.79836  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -182.783  16.3895  2.79836  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2838 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -183.163  16.3895  2.79836  0.55
protocols.relax.FastRelax: {0} CMD: min  -204.946  16.3807  2.73419  0.55
protocols.relax.FastRelax: {0} MRP: 1  -204.946  -204.946  16.3807  2.73419
protocols.relax.FastRelax: {0} CMD: accept_to_best  -204.946  16.3807  2.73419  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -204.946  16.3807  2.73419  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -204.946  16.3807  2.73419  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -262.146  16.3807  2.73419  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3206 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -275.941  16.3807  2.73419  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -273.881  16.3807  2.73419  0.02805
protocols.relax.FastRelax: {0} CMD: min  -320.879  16.2443  2.9186  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -320.879  16.2443  2.9186  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -203.988  16.2443  2.9186  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3141 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -227.31  16.2443  2.9186  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -221.723  16.2443  2.9186  0.154
protocols.relax.FastRelax: {0} CMD: min  -261.108  16.3332  2.9812  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -261.108  16.3332  2.9812  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -219.722  16.3332  2.9812  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2871 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -220.174  16.3332  2.9812  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -216.971  16.3332  2.9812  0.31955
protocols.relax.FastRelax: {0} CMD: min  -229.79  16.396  3.03674  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -229.79  16.396  3.03674  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -192.337  16.396  3.03674  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2820 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -192.833  16.396  3.03674  0.55
protocols.relax.FastRelax: {0} CMD: min  -209.038  16.4339  2.95966  0.55
protocols.relax.FastRelax: {0} MRP: 2  -209.038  -209.038  16.4339  2.95966
protocols.relax.FastRelax: {0} CMD: accept_to_best  -209.038  16.4339  2.95966  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -209.038  16.4339  2.95966  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -209.038  16.4339  2.95966  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -266.411  16.4339  2.95966  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2956 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -278.397  16.4339  2.95966  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -275.986  16.4339  2.95966  0.02805
protocols.relax.FastRelax: {0} CMD: min  -310.897  16.3081  2.90667  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -310.897  16.3081  2.90667  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -192.805  16.3081  2.90667  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2926 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -222.687  16.3081  2.90667  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -217.337  16.3081  2.90667  0.154
protocols.relax.FastRelax: {0} CMD: min  -261.728  16.3959  3.0743  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -261.728  16.3959  3.0743  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -225.552  16.3959  3.0743  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2772 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -225.595  16.3959  3.0743  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -222.755  16.3959  3.0743  0.31955
protocols.relax.FastRelax: {0} CMD: min  -229.183  16.4711  3.13305  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -229.183  16.4711  3.13305  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -190.432  16.4711  3.13305  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2581 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -190.647  16.4711  3.13305  0.55
protocols.relax.FastRelax: {0} CMD: min  -211.651  16.4749  3.14488  0.55
protocols.relax.FastRelax: {0} MRP: 3  -211.651  -211.651  16.4749  3.14488
protocols.relax.FastRelax: {0} CMD: accept_to_best  -211.651  16.4749  3.14488  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -211.651  16.4749  3.14488  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -211.651  16.4749  3.14488  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -269.557  16.4749  3.14488  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3106 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -281.497  16.4749  3.14488  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -279.315  16.4749  3.14488  0.02805
protocols.relax.FastRelax: {0} CMD: min  -328.03  16.29  3.15786  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -328.03  16.29  3.15786  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -188.244  16.29  3.15786  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3095 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -215.844  16.29  3.15786  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -208.718  16.29  3.15786  0.154
protocols.relax.FastRelax: {0} CMD: min  -270.668  16.3886  3.12456  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -270.668  16.3886  3.12456  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -229.116  16.3886  3.12456  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2860 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -229.832  16.3886  3.12456  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -226.592  16.3886  3.12456  0.31955
protocols.relax.FastRelax: {0} CMD: min  -236.913  16.4418  3.12109  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -236.913  16.4418  3.12109  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -197.389  16.4418  3.12109  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2787 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -197.475  16.4418  3.12109  0.55
protocols.relax.FastRelax: {0} CMD: min  -212.506  16.4585  3.16685  0.55
protocols.relax.FastRelax: {0} MRP: 4  -212.506  -212.506  16.4585  3.16685
protocols.relax.FastRelax: {0} CMD: accept_to_best  -212.506  16.4585  3.16685  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -212.506  16.4585  3.16685  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_9.pdb
protocols.relax.FastRelax: {0} CMD: repeat  77326.7  11.3876  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  77326.7  11.3876  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7060.03  11.3876  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2606 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  144.673  11.3876  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  174.071  11.3876  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -2.44144  10.4774  5.22969  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -2.44144  10.4774  5.22969  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  1024.11  10.4774  5.22969  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2496 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  345.62  10.4774  5.22969  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  376.985  10.4774  5.22969  0.154
protocols.relax.FastRelax: {0} CMD: min  -215.376  10.3414  5.19631  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -215.376  10.3414  5.19631  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -174.24  10.3414  5.19631  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2296 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -179.281  10.3414  5.19631  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -176.15  10.3414  5.19631  0.31955
protocols.relax.FastRelax: {0} CMD: min  -186.947  10.3831  4.98274  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -186.947  10.3831  4.98274  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -146.497  10.3831  4.98274  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2250 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -146.725  10.3831  4.98274  0.55
protocols.relax.FastRelax: {0} CMD: min  -182.22  10.1963  5.68491  0.55
protocols.relax.FastRelax: {0} MRP: 0  -182.22  -182.22  10.1963  5.68491
protocols.relax.FastRelax: {0} CMD: accept_to_best  -182.22  10.1963  5.68491  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -182.22  10.1963  5.68491  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -182.22  10.1963  5.68491  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -242.715  10.1963  5.68491  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2472 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -256.434  10.1963  5.68491  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -252.995  10.1963  5.68491  0.02805
protocols.relax.FastRelax: {0} CMD: min  -307.24  9.98579  6.03948  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -307.24  9.98579  6.03948  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -172.613  9.98579  6.03948  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2520 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -191.734  9.98579  6.03948  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -184.161  9.98579  6.03948  0.154
protocols.relax.FastRelax: {0} CMD: min  -257.604  10.0052  6.07758  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -257.604  10.0052  6.07758  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -216.158  10.0052  6.07758  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2361 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -216.552  10.0052  6.07758  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -213.33  10.0052  6.07758  0.31955
protocols.relax.FastRelax: {0} CMD: min  -222.314  9.98536  6.20389  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -222.314  9.98536  6.20389  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -179.919  9.98536  6.20389  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2284 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -179.338  9.98536  6.20389  0.55
protocols.relax.FastRelax: {0} CMD: min  -205.844  9.88646  7.03575  0.55
protocols.relax.FastRelax: {0} MRP: 1  -205.844  -205.844  9.88646  7.03575
protocols.relax.FastRelax: {0} CMD: accept_to_best  -205.844  9.88646  7.03575  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -205.844  9.88646  7.03575  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -205.844  9.88646  7.03575  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -269.175  9.88646  7.03575  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2543 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -276.134  9.88646  7.03575  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -274.714  9.88646  7.03575  0.02805
protocols.relax.FastRelax: {0} CMD: min  -317.108  9.65878  6.83446  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -317.108  9.65878  6.83446  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -217.928  9.65878  6.83446  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2519 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -232.745  9.65878  6.83446  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -227.298  9.65878  6.83446  0.154
protocols.relax.FastRelax: {0} CMD: min  -263.908  9.71389  7.08522  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -263.908  9.71389  7.08522  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -222.615  9.71389  7.08522  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2442 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -222.699  9.71389  7.08522  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -219.481  9.71389  7.08522  0.31955
protocols.relax.FastRelax: {0} CMD: min  -231.249  9.81995  7.19555  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -231.249  9.81995  7.19555  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -190.568  9.81995  7.19555  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2317 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -190.956  9.81995  7.19555  0.55
protocols.relax.FastRelax: {0} CMD: min  -213.374  9.78595  7.81947  0.55
protocols.relax.FastRelax: {0} MRP: 2  -213.374  -213.374  9.78595  7.81947
protocols.relax.FastRelax: {0} CMD: accept_to_best  -213.374  9.78595  7.81947  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -213.374  9.78595  7.81947  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -213.374  9.78595  7.81947  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -279.673  9.78595  7.81947  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2596 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -286.118  9.78595  7.81947  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -284.448  9.78595  7.81947  0.02805
protocols.relax.FastRelax: {0} CMD: min  -337.629  9.58664  8.24037  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -337.629  9.58664  8.24037  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -185.297  9.58664  8.24037  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2789 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -218.922  9.58664  8.24037  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -211.288  9.58664  8.24037  0.154
protocols.relax.FastRelax: {0} CMD: min  -282.533  9.72206  8.55262  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -282.533  9.72206  8.55262  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -237.616  9.72206  8.55262  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2572 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -237.907  9.72206  8.55262  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -234.374  9.72206  8.55262  0.31955
protocols.relax.FastRelax: {0} CMD: min  -245.199  9.72781  8.52533  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -245.199  9.72781  8.52533  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -199.425  9.72781  8.52533  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2462 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -199.662  9.72781  8.52533  0.55
protocols.relax.FastRelax: {0} CMD: min  -217.488  9.7681  8.5314  0.55
protocols.relax.FastRelax: {0} MRP: 3  -217.488  -217.488  9.7681  8.5314
protocols.relax.FastRelax: {0} CMD: accept_to_best  -217.488  9.7681  8.5314  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -217.488  9.7681  8.5314  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -217.488  9.7681  8.5314  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -285.228  9.7681  8.5314  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2772 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -291.738  9.7681  8.5314  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -290.123  9.7681  8.5314  0.02805
protocols.relax.FastRelax: {0} CMD: min  -352.042  9.72265  8.49224  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -352.042  9.72265  8.49224  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -207.967  9.72265  8.49224  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2733 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -222.664  9.72265  8.49224  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -214.539  9.72265  8.49224  0.154
protocols.relax.FastRelax: {0} CMD: min  -284.922  9.68516  8.40343  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -284.922  9.68516  8.40343  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -236.572  9.68516  8.40343  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2613 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -236.806  9.68516  8.40343  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -232.985  9.68516  8.40343  0.31955
protocols.relax.FastRelax: {0} CMD: min  -243.018  9.66086  8.33563  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -243.018  9.66086  8.33563  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -193.68  9.66086  8.33563  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2513 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -193.924  9.66086  8.33563  0.55
protocols.relax.FastRelax: {0} CMD: min  -221.43  9.85116  8.75971  0.55
protocols.relax.FastRelax: {0} MRP: 4  -221.43  -221.43  9.85116  8.75971
protocols.relax.FastRelax: {0} CMD: accept_to_best  -221.43  9.85116  8.75971  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -221.43  9.85116  8.75971  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_20.pdb
protocols.relax.FastRelax: {0} CMD: repeat  71174.1  18.8525  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  71174.1  18.8525  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7200.56  18.8525  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2170 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  357.503  18.8525  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  386.06  18.8525  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -192.551  18.6915  9.63613  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -192.551  18.6915  9.63613  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  186.118  18.6915  9.63613  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2714 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -121.43  18.6915  9.63613  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -113.997  18.6915  9.63613  0.154
protocols.relax.FastRelax: {0} CMD: min  -223.893  19.2178  9.72651  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -223.893  19.2178  9.72651  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -182.193  19.2178  9.72651  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2604 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -186.572  19.2178  9.72651  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -183.544  19.2178  9.72651  0.31955
protocols.relax.FastRelax: {0} CMD: min  -187.282  19.3073  9.70637  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -187.282  19.3073  9.70637  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -134.666  19.3073  9.70637  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2587 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -135.457  19.3073  9.70637  0.55
protocols.relax.FastRelax: {0} CMD: min  -190.631  19.2705  9.09313  0.55
protocols.relax.FastRelax: {0} MRP: 0  -190.631  -190.631  19.2705  9.09313
protocols.relax.FastRelax: {0} CMD: accept_to_best  -190.631  19.2705  9.09313  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -190.631  19.2705  9.09313  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -190.631  19.2705  9.09313  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -254.793  19.2705  9.09313  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2617 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -267.477  19.2705  9.09313  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -263.21  19.2705  9.09313  0.02805
protocols.relax.FastRelax: {0} CMD: min  -311.012  18.5198  9.16574  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -311.012  18.5198  9.16574  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -192.409  18.5198  9.16574  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2774 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -222.19  18.5198  9.16574  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -216.762  18.5198  9.16574  0.154
protocols.relax.FastRelax: {0} CMD: min  -255.464  18.6863  9.20289  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -255.464  18.6863  9.20289  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -212.861  18.6863  9.20289  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2737 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -213.146  18.6863  9.20289  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -209.93  18.6863  9.20289  0.31955
protocols.relax.FastRelax: {0} CMD: min  -218.689  18.8945  9.04815  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -218.689  18.8945  9.04815  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -174.884  18.8945  9.04815  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2533 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -175.413  18.8945  9.04815  0.55
protocols.relax.FastRelax: {0} CMD: min  -198.412  18.6893  8.80065  0.55
protocols.relax.FastRelax: {0} MRP: 1  -198.412  -198.412  18.6893  8.80065
protocols.relax.FastRelax: {0} CMD: accept_to_best  -198.412  18.6893  8.80065  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -198.412  18.6893  8.80065  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -198.412  18.6893  8.80065  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -266.91  18.6893  8.80065  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2760 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -278.28  18.6893  8.80065  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -276.026  18.6893  8.80065  0.02805
protocols.relax.FastRelax: {0} CMD: min  -313.215  17.8664  9.44348  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -313.215  17.8664  9.44348  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -164.351  17.8664  9.44348  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2883 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -207.209  17.8664  9.44348  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -200.864  17.8664  9.44348  0.154
protocols.relax.FastRelax: {0} CMD: min  -258.377  18.3339  9.01296  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -258.377  18.3339  9.01296  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -214.802  18.3339  9.01296  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2636 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -215.988  18.3339  9.01296  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -212.66  18.3339  9.01296  0.31955
protocols.relax.FastRelax: {0} CMD: min  -221.458  18.3835  9.28239  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -221.458  18.3835  9.28239  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -173.335  18.3835  9.28239  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2580 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -174.174  18.3835  9.28239  0.55
protocols.relax.FastRelax: {0} CMD: min  -196.804  18.8029  9.0965  0.55
protocols.relax.FastRelax: {0} MRP: 2  -196.804  -198.412  18.6893  8.80065
protocols.relax.FastRelax: {0} CMD: accept_to_best  -196.804  18.8029  9.0965  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -196.804  18.8029  9.0965  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -196.804  18.8029  9.0965  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -262.971  18.8029  9.0965  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2774 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -278.791  18.8029  9.0965  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -276.682  18.8029  9.0965  0.02805
protocols.relax.FastRelax: {0} CMD: min  -310.712  18.2334  9.41517  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -310.712  18.2334  9.41517  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -193.975  18.2334  9.41517  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2868 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -224.529  18.2334  9.41517  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -219.28  18.2334  9.41517  0.154
protocols.relax.FastRelax: {0} CMD: min  -254.396  18.4597  9.19788  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -254.396  18.4597  9.19788  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -212.846  18.4597  9.19788  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2733 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -214.281  18.4597  9.19788  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -211.082  18.4597  9.19788  0.31955
protocols.relax.FastRelax: {0} CMD: min  -223.527  18.4893  9.08686  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -223.527  18.4893  9.08686  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -182.674  18.4893  9.08686  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2666 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -182.814  18.4893  9.08686  0.55
protocols.relax.FastRelax: {0} CMD: min  -199.851  18.5399  8.82649  0.55
protocols.relax.FastRelax: {0} MRP: 3  -199.851  -199.851  18.5399  8.82649
protocols.relax.FastRelax: {0} CMD: accept_to_best  -199.851  18.5399  8.82649  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -199.851  18.5399  8.82649  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -199.851  18.5399  8.82649  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -266.112  18.5399  8.82649  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2834 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -279.57  18.5399  8.82649  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -276.776  18.5399  8.82649  0.02805
protocols.relax.FastRelax: {0} CMD: min  -307.407  18.1592  8.93716  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -307.407  18.1592  8.93716  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -166.115  18.1592  8.93716  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2790 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -219.263  18.1592  8.93716  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -213.557  18.1592  8.93716  0.154
protocols.relax.FastRelax: {0} CMD: min  -260.199  18.275  8.63612  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -260.199  18.275  8.63612  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -218.988  18.275  8.63612  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2713 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -221.618  18.275  8.63612  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -218.423  18.275  8.63612  0.31955
protocols.relax.FastRelax: {0} CMD: min  -232.152  18.4022  8.8849  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -232.152  18.4022  8.8849  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -192.573  18.4022  8.8849  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2554 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -192.59  18.4022  8.8849  0.55
protocols.relax.FastRelax: {0} CMD: min  -202.634  18.4698  8.87054  0.55
protocols.relax.FastRelax: {0} MRP: 4  -202.634  -202.634  18.4698  8.87054
protocols.relax.FastRelax: {0} CMD: accept_to_best  -202.634  18.4698  8.87054  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -202.634  18.4698  8.87054  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_28.pdb
protocols.relax.FastRelax: {0} CMD: repeat  67255.8  14.1891  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  67255.8  14.1891  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  6570.5  14.1891  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3263 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -87.7213  14.1891  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -59.7367  14.1891  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -255.796  14.4526  2.76521  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -255.796  14.4526  2.76521  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -112.854  14.4526  2.76521  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3005 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -151.878  14.4526  2.76521  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -144.857  14.4526  2.76521  0.154
protocols.relax.FastRelax: {0} CMD: min  -245.631  14.1634  2.92411  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -245.631  14.1634  2.92411  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -202.797  14.1634  2.92411  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2886 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -205.333  14.1634  2.92411  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -201.947  14.1634  2.92411  0.31955
protocols.relax.FastRelax: {0} CMD: min  -208.211  14.2159  2.83486  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -208.211  14.2159  2.83486  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -157.652  14.2159  2.83486  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2687 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -157.739  14.2159  2.83486  0.55
protocols.relax.FastRelax: {0} CMD: min  -221.947  14.452  3.48401  0.55
protocols.relax.FastRelax: {0} MRP: 0  -221.947  -221.947  14.452  3.48401
protocols.relax.FastRelax: {0} CMD: accept_to_best  -221.947  14.452  3.48401  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -221.947  14.452  3.48401  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -221.947  14.452  3.48401  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -281.769  14.452  3.48401  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3135 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -298.57  14.452  3.48401  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -294.406  14.452  3.48401  0.02805
protocols.relax.FastRelax: {0} CMD: min  -343.884  14.0056  3.62709  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -343.884  14.0056  3.62709  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -222.665  14.0056  3.62709  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3438 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -243.662  14.0056  3.62709  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -237.804  14.0056  3.62709  0.154
protocols.relax.FastRelax: {0} CMD: min  -283.653  14.2475  3.61672  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -283.653  14.2475  3.61672  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -242.463  14.2475  3.61672  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3084 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -243.958  14.2475  3.61672  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -240.957  14.2475  3.61672  0.31955
protocols.relax.FastRelax: {0} CMD: min  -254.757  14.284  3.55274  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -254.757  14.284  3.55274  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -215.47  14.284  3.55274  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2841 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -215.457  14.284  3.55274  0.55
protocols.relax.FastRelax: {0} CMD: min  -247.549  14.4433  3.57364  0.55
protocols.relax.FastRelax: {0} MRP: 1  -247.549  -247.549  14.4433  3.57364
protocols.relax.FastRelax: {0} CMD: accept_to_best  -247.549  14.4433  3.57364  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -247.549  14.4433  3.57364  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -247.549  14.4433  3.57364  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -307.268  14.4433  3.57364  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3097 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -321.535  14.4433  3.57364  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -317.509  14.4433  3.57364  0.02805
protocols.relax.FastRelax: {0} CMD: min  -363.085  14.076  3.89326  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -363.085  14.076  3.89326  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -231.378  14.076  3.89326  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3234 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -249.414  14.076  3.89326  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -242.632  14.076  3.89326  0.154
protocols.relax.FastRelax: {0} CMD: min  -295.443  13.9391  3.68682  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -295.443  13.9391  3.68682  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -249.383  13.9391  3.68682  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3171 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -250.198  13.9391  3.68682  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -246.641  13.9391  3.68682  0.31955
protocols.relax.FastRelax: {0} CMD: min  -262.137  13.9585  3.68879  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -262.137  13.9585  3.68879  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -218.943  13.9585  3.68879  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2729 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -219.427  13.9585  3.68879  0.55
protocols.relax.FastRelax: {0} CMD: min  -246.878  14.0769  3.46725  0.55
protocols.relax.FastRelax: {0} MRP: 2  -246.878  -247.549  14.4433  3.57364
protocols.relax.FastRelax: {0} CMD: accept_to_best  -246.878  14.0769  3.46725  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -246.878  14.0769  3.46725  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -246.878  14.0769  3.46725  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -310.292  14.0769  3.46725  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2878 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -317.957  14.0769  3.46725  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -315.497  14.0769  3.46725  0.02805
protocols.relax.FastRelax: {0} CMD: min  -360.181  13.763  3.4079  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -360.181  13.763  3.4079  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -245.478  13.763  3.4079  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3203 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -256.232  13.763  3.4079  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -249.65  13.763  3.4079  0.154
protocols.relax.FastRelax: {0} CMD: min  -303.86  13.8532  3.44267  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -303.86  13.8532  3.44267  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -261.617  13.8532  3.44267  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2887 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -261.891  13.8532  3.44267  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -258.546  13.8532  3.44267  0.31955
protocols.relax.FastRelax: {0} CMD: min  -268.066  13.8897  3.50723  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -268.066  13.8897  3.50723  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -222.297  13.8897  3.50723  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2593 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -222.944  13.8897  3.50723  0.55
protocols.relax.FastRelax: {0} CMD: min  -246.941  14.1154  3.43388  0.55
protocols.relax.FastRelax: {0} MRP: 3  -246.941  -247.549  14.4433  3.57364
protocols.relax.FastRelax: {0} CMD: accept_to_best  -246.941  14.1154  3.43388  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -246.941  14.1154  3.43388  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -246.941  14.1154  3.43388  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -309.937  14.1154  3.43388  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3048 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -320.073  14.1154  3.43388  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -317.99  14.1154  3.43388  0.02805
protocols.relax.FastRelax: {0} CMD: min  -358.471  13.8572  3.31003  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -358.471  13.8572  3.31003  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -237.254  13.8572  3.31003  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3161 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -252.779  13.8572  3.31003  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -245.824  13.8572  3.31003  0.154
protocols.relax.FastRelax: {0} CMD: min  -303.237  13.8571  3.44256  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -303.237  13.8571  3.44256  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -260.291  13.8571  3.44256  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3022 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -260.67  13.8571  3.44256  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -257.288  13.8571  3.44256  0.31955
protocols.relax.FastRelax: {0} CMD: min  -270.633  13.9605  3.42705  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -270.633  13.9605  3.42705  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -228.661  13.9605  3.42705  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2952 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -228.716  13.9605  3.42705  0.55
protocols.relax.FastRelax: {0} CMD: min  -247.929  14.166  3.42068  0.55
protocols.relax.FastRelax: {0} MRP: 4  -247.929  -247.929  14.166  3.42068
protocols.relax.FastRelax: {0} CMD: accept_to_best  -247.929  14.166  3.42068  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -247.929  14.166  3.42068  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_8.pdb
protocols.relax.FastRelax: {0} CMD: repeat  76095  16.1597  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  76095  16.1597  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7603.9  16.1597  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2836 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -20.2145  16.1597  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  19.0612  16.1597  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -223.616  15.6974  2.40958  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -223.616  15.6974  2.40958  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -75.348  15.6974  2.40958  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2880 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -116.511  15.6974  2.40958  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -109.653  15.6974  2.40958  0.154
protocols.relax.FastRelax: {0} CMD: min  -184.987  15.59  2.89985  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -184.987  15.59  2.89985  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -140.531  15.59  2.89985  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2690 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -147.299  15.59  2.89985  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -144.129  15.59  2.89985  0.31955
protocols.relax.FastRelax: {0} CMD: min  -156.58  15.4553  3.00727  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -156.58  15.4553  3.00727  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -111.858  15.4553  3.00727  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2538 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -111.603  15.4553  3.00727  0.55
protocols.relax.FastRelax: {0} CMD: min  -176.708  15.7044  3.50462  0.55
protocols.relax.FastRelax: {0} MRP: 0  -176.708  -176.708  15.7044  3.50462
protocols.relax.FastRelax: {0} CMD: accept_to_best  -176.708  15.7044  3.50462  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -176.708  15.7044  3.50462  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -176.708  15.7044  3.50462  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -238.945  15.7044  3.50462  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2745 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -259.883  15.7044  3.50462  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -256.644  15.7044  3.50462  0.02805
protocols.relax.FastRelax: {0} CMD: min  -300.586  15.4141  3.99818  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -300.586  15.4141  3.99818  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -185.289  15.4141  3.99818  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2989 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -203.529  15.4141  3.99818  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -198.586  15.4141  3.99818  0.154
protocols.relax.FastRelax: {0} CMD: min  -236.739  15.4713  3.82752  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -236.739  15.4713  3.82752  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -193.936  15.4713  3.82752  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2631 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -195.62  15.4713  3.82752  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -192.343  15.4713  3.82752  0.31955
protocols.relax.FastRelax: {0} CMD: min  -205.024  15.5211  3.81445  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -205.024  15.5211  3.81445  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -163.285  15.5211  3.81445  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2554 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -163.568  15.5211  3.81445  0.55
protocols.relax.FastRelax: {0} CMD: min  -189.289  15.5321  3.84372  0.55
protocols.relax.FastRelax: {0} MRP: 1  -189.289  -189.289  15.5321  3.84372
protocols.relax.FastRelax: {0} CMD: accept_to_best  -189.289  15.5321  3.84372  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -189.289  15.5321  3.84372  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -189.289  15.5321  3.84372  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -253.861  15.5321  3.84372  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2957 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -267.431  15.5321  3.84372  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -264.843  15.5321  3.84372  0.02805
protocols.relax.FastRelax: {0} CMD: min  -319.44  15.4244  4.0494  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -319.44  15.4244  4.0494  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -194.7  15.4244  4.0494  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2810 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -209.537  15.4244  4.0494  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -202.395  15.4244  4.0494  0.154
protocols.relax.FastRelax: {0} CMD: min  -256.269  15.4163  3.87387  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -256.269  15.4163  3.87387  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -209.586  15.4163  3.87387  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2768 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -210.135  15.4163  3.87387  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -206.477  15.4163  3.87387  0.31955
protocols.relax.FastRelax: {0} CMD: min  -222.254  15.4227  3.84933  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -222.254  15.4227  3.84933  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -178.734  15.4227  3.84933  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2621 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -178.935  15.4227  3.84933  0.55
protocols.relax.FastRelax: {0} CMD: min  -198.406  15.6098  3.76065  0.55
protocols.relax.FastRelax: {0} MRP: 2  -198.406  -198.406  15.6098  3.76065
protocols.relax.FastRelax: {0} CMD: accept_to_best  -198.406  15.6098  3.76065  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -198.406  15.6098  3.76065  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -198.406  15.6098  3.76065  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -263.674  15.6098  3.76065  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2995 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -271.856  15.6098  3.76065  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -269.542  15.6098  3.76065  0.02805
protocols.relax.FastRelax: {0} CMD: min  -319.787  15.4985  4.06224  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -319.787  15.4985  4.06224  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -188.483  15.4985  4.06224  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2913 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -209.868  15.4985  4.06224  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -202.994  15.4985  4.06224  0.154
protocols.relax.FastRelax: {0} CMD: min  -256.751  15.5654  3.83044  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -256.751  15.5654  3.83044  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -214.68  15.5654  3.83044  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2783 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -216.771  15.5654  3.83044  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -213.411  15.5654  3.83044  0.31955
protocols.relax.FastRelax: {0} CMD: min  -224.573  15.5325  3.84973  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -224.573  15.5325  3.84973  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -182.735  15.5325  3.84973  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2644 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -182.849  15.5325  3.84973  0.55
protocols.relax.FastRelax: {0} CMD: min  -198.983  15.6249  3.77869  0.55
protocols.relax.FastRelax: {0} MRP: 3  -198.983  -198.983  15.6249  3.77869
protocols.relax.FastRelax: {0} CMD: accept_to_best  -198.983  15.6249  3.77869  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -198.983  15.6249  3.77869  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -198.983  15.6249  3.77869  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -264.398  15.6249  3.77869  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2988 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -272.435  15.6249  3.77869  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -270.4  15.6249  3.77869  0.02805
protocols.relax.FastRelax: {0} CMD: min  -320.036  15.5282  4.06812  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -320.036  15.5282  4.06812  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -202.625  15.5282  4.06812  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2861 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -216.847  15.5282  4.06812  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -210.185  15.5282  4.06812  0.154
protocols.relax.FastRelax: {0} CMD: min  -256.515  15.6063  3.94825  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -256.515  15.6063  3.94825  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -210.641  15.6063  3.94825  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2663 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -212.248  15.6063  3.94825  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -208.805  15.6063  3.94825  0.31955
protocols.relax.FastRelax: {0} CMD: min  -221.268  15.5388  3.82662  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -221.268  15.5388  3.82662  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -173.573  15.5388  3.82662  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2588 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -174.563  15.5388  3.82662  0.55
protocols.relax.FastRelax: {0} CMD: min  -198.979  15.6196  3.78566  0.55
protocols.relax.FastRelax: {0} MRP: 4  -198.979  -198.983  15.6249  3.77869
protocols.relax.FastRelax: {0} CMD: accept_to_best  -198.979  15.6196  3.78566  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -198.979  15.6196  3.78566  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_19.pdb
protocols.relax.FastRelax: {0} CMD: repeat  70056.8  16.7079  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  70056.8  16.7079  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7035.71  16.7079  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3512 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  164.412  16.7079  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  201.811  16.7079  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -269.058  17.0244  2.23697  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -269.058  17.0244  2.23697  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -114.78  17.0244  2.23697  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3413 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -147.529  17.0244  2.23697  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -139.271  17.0244  2.23697  0.154
protocols.relax.FastRelax: {0} CMD: min  -209.882  16.8425  2.04173  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -209.882  16.8425  2.04173  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -158.375  16.8425  2.04173  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2801 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -159.787  16.8425  2.04173  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -155.877  16.8425  2.04173  0.31955
protocols.relax.FastRelax: {0} CMD: min  -172.452  16.7753  2.07189  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -172.452  16.7753  2.07189  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -124.282  16.7753  2.07189  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2599 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -125.019  16.7753  2.07189  0.55
protocols.relax.FastRelax: {0} CMD: min  -193.533  16.0463  2.53605  0.55
protocols.relax.FastRelax: {0} MRP: 0  -193.533  -193.533  16.0463  2.53605
protocols.relax.FastRelax: {0} CMD: accept_to_best  -193.533  16.0463  2.53605  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -193.533  16.0463  2.53605  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -193.533  16.0463  2.53605  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -252.71  16.0463  2.53605  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3478 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -271.963  16.0463  2.53605  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -267.881  16.0463  2.53605  0.02805
protocols.relax.FastRelax: {0} CMD: min  -333.123  15.3548  3.66733  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -333.123  15.3548  3.66733  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -178.986  15.3548  3.66733  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3469 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -200.24  15.3548  3.66733  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -192.378  15.3548  3.66733  0.154
protocols.relax.FastRelax: {0} CMD: min  -260.167  15.2711  4.10885  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -260.167  15.2711  4.10885  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -211.23  15.2711  4.10885  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3267 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -214.379  15.2711  4.10885  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -210.661  15.2711  4.10885  0.31955
protocols.relax.FastRelax: {0} CMD: min  -234.68  15.3088  4.15055  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -234.68  15.3088  4.15055  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -195.269  15.3088  4.15055  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3178 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -196.132  15.3088  4.15055  0.55
protocols.relax.FastRelax: {0} CMD: min  -219.399  15.3969  4.04702  0.55
protocols.relax.FastRelax: {0} MRP: 1  -219.399  -219.399  15.3969  4.04702
protocols.relax.FastRelax: {0} CMD: accept_to_best  -219.399  15.3969  4.04702  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -219.399  15.3969  4.04702  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -219.399  15.3969  4.04702  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -280.882  15.3969  4.04702  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3858 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -295.59  15.3969  4.04702  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -292.654  15.3969  4.04702  0.02805
protocols.relax.FastRelax: {0} CMD: min  -350.623  15.2502  4.05313  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -350.623  15.2502  4.05313  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -215.49  15.2502  4.05313  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3637 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -233.325  15.2502  4.05313  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -226.152  15.2502  4.05313  0.154
protocols.relax.FastRelax: {0} CMD: min  -290.599  15.3268  3.95089  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -290.599  15.3268  3.95089  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -248.58  15.3268  3.95089  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3515 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -248.442  15.3268  3.95089  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -245.138  15.3268  3.95089  0.31955
protocols.relax.FastRelax: {0} CMD: min  -254.289  15.391  3.92152  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -254.289  15.391  3.92152  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -212.011  15.391  3.92152  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3182 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -212.345  15.391  3.92152  0.55
protocols.relax.FastRelax: {0} CMD: min  -235.933  15.385  3.98562  0.55
protocols.relax.FastRelax: {0} MRP: 2  -235.933  -235.933  15.385  3.98562
protocols.relax.FastRelax: {0} CMD: accept_to_best  -235.933  15.385  3.98562  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -235.933  15.385  3.98562  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -235.933  15.385  3.98562  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -298.076  15.385  3.98562  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3803 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -310.015  15.385  3.98562  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -307.958  15.385  3.98562  0.02805
protocols.relax.FastRelax: {0} CMD: min  -348.63  15.2205  4.32737  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -348.63  15.2205  4.32737  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -235.338  15.2205  4.32737  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3872 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -263.451  15.2205  4.32737  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -258.039  15.2205  4.32737  0.154
protocols.relax.FastRelax: {0} CMD: min  -297.024  15.2781  4.15385  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -297.024  15.2781  4.15385  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -256.224  15.2781  4.15385  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3447 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -256.352  15.2781  4.15385  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -253.143  15.2781  4.15385  0.31955
protocols.relax.FastRelax: {0} CMD: min  -263.745  15.3216  4.09162  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -263.745  15.3216  4.09162  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -221.666  15.3216  4.09162  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3283 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -222.075  15.3216  4.09162  0.55
protocols.relax.FastRelax: {0} CMD: min  -245.59  15.3802  4.06107  0.55
protocols.relax.FastRelax: {0} MRP: 3  -245.59  -245.59  15.3802  4.06107
protocols.relax.FastRelax: {0} CMD: accept_to_best  -245.59  15.3802  4.06107  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -245.59  15.3802  4.06107  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -245.59  15.3802  4.06107  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -308.92  15.3802  4.06107  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3857 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -319.713  15.3802  4.06107  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -317.468  15.3802  4.06107  0.02805
protocols.relax.FastRelax: {0} CMD: min  -364.254  15.1323  4.28607  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -364.254  15.1323  4.28607  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -211.778  15.1323  4.28607  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3843 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -250.178  15.1323  4.28607  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -242.747  15.1323  4.28607  0.154
protocols.relax.FastRelax: {0} CMD: min  -305.915  15.2439  4.07808  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -305.915  15.2439  4.07808  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -261.852  15.2439  4.07808  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3364 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -262.087  15.2439  4.07808  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -258.645  15.2439  4.07808  0.31955
protocols.relax.FastRelax: {0} CMD: min  -271.222  15.3266  4.05014  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -271.222  15.3266  4.05014  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -228.261  15.3266  4.05014  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3229 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -228.331  15.3266  4.05014  0.55
protocols.relax.FastRelax: {0} CMD: min  -246.444  15.3828  4.05951  0.55
protocols.relax.FastRelax: {0} MRP: 4  -246.444  -246.444  15.3828  4.05951
protocols.relax.FastRelax: {0} CMD: accept_to_best  -246.444  15.3828  4.05951  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -246.444  15.3828  4.05951  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_29.pdb
protocols.relax.FastRelax: {0} CMD: repeat  77548.3  15.2346  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  77548.3  15.2346  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  8106.52  15.2346  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2593 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  105.541  15.2346  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  128.093  15.2346  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -278.856  15.3867  1.84109  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -278.856  15.3867  1.84109  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -126.383  15.3867  1.84109  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2866 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -142.797  15.3867  1.84109  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -134.021  15.3867  1.84109  0.154
protocols.relax.FastRelax: {0} CMD: min  -210.45  15.5384  1.8835  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -210.45  15.5384  1.8835  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -159.219  15.5384  1.8835  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2462 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -159.451  15.5384  1.8835  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -155.371  15.5384  1.8835  0.31955
protocols.relax.FastRelax: {0} CMD: min  -163.74  15.5569  1.77773  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -163.74  15.5569  1.77773  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -104.645  15.5569  1.77773  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2361 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -106.604  15.5569  1.77773  0.55
protocols.relax.FastRelax: {0} CMD: min  -172.006  15.6431  2.7108  0.55
protocols.relax.FastRelax: {0} MRP: 0  -172.006  -172.006  15.6431  2.7108
protocols.relax.FastRelax: {0} CMD: accept_to_best  -172.006  15.6431  2.7108  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -172.006  15.6431  2.7108  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -172.006  15.6431  2.7108  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -238.885  15.6431  2.7108  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2513 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -256.278  15.6431  2.7108  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -253.312  15.6431  2.7108  0.02805
protocols.relax.FastRelax: {0} CMD: min  -311.315  15.5209  3.33237  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -311.315  15.5209  3.33237  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -150.597  15.5209  3.33237  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3029 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -185.178  15.5209  3.33237  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -177.458  15.5209  3.33237  0.154
protocols.relax.FastRelax: {0} CMD: min  -240.897  15.6014  3.10814  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -240.897  15.6014  3.10814  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -189.327  15.6014  3.10814  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2546 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -189.774  15.6014  3.10814  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -185.749  15.6014  3.10814  0.31955
protocols.relax.FastRelax: {0} CMD: min  -197.995  15.5815  3.05186  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -197.995  15.5815  3.05186  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -144.076  15.5815  3.05186  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2465 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -144.629  15.5815  3.05186  0.55
protocols.relax.FastRelax: {0} CMD: min  -176.113  15.5422  2.64014  0.55
protocols.relax.FastRelax: {0} MRP: 1  -176.113  -176.113  15.5422  2.64014
protocols.relax.FastRelax: {0} CMD: accept_to_best  -176.113  15.5422  2.64014  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -176.113  15.5422  2.64014  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -176.113  15.5422  2.64014  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -250.09  15.5422  2.64014  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2761 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -267.486  15.5422  2.64014  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -263.879  15.5422  2.64014  0.02805
protocols.relax.FastRelax: {0} CMD: min  -331.45  15.2293  2.95785  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -331.45  15.2293  2.95785  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -166.063  15.2293  2.95785  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2990 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -192.393  15.2293  2.95785  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -183.577  15.2293  2.95785  0.154
protocols.relax.FastRelax: {0} CMD: min  -254.779  15.304  2.68369  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -254.779  15.304  2.68369  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -202.396  15.304  2.68369  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2629 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -203.616  15.304  2.68369  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -199.515  15.304  2.68369  0.31955
protocols.relax.FastRelax: {0} CMD: min  -215.921  15.4445  2.68112  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -215.921  15.4445  2.68112  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -167.451  15.4445  2.68112  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2545 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -167.662  15.4445  2.68112  0.55
protocols.relax.FastRelax: {0} CMD: min  -194.797  15.2786  2.42481  0.55
protocols.relax.FastRelax: {0} MRP: 2  -194.797  -194.797  15.2786  2.42481
protocols.relax.FastRelax: {0} CMD: accept_to_best  -194.797  15.2786  2.42481  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -194.797  15.2786  2.42481  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -194.797  15.2786  2.42481  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -267.152  15.2786  2.42481  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2998 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -282.182  15.2786  2.42481  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -279.625  15.2786  2.42481  0.02805
protocols.relax.FastRelax: {0} CMD: min  -341.259  14.8654  2.78533  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -341.259  14.8654  2.78533  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -184.281  14.8654  2.78533  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3342 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -208.794  14.8654  2.78533  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -200.268  14.8654  2.78533  0.154
protocols.relax.FastRelax: {0} CMD: min  -271.644  14.9911  2.71043  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -271.644  14.9911  2.71043  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -220.355  14.9911  2.71043  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3013 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -220.892  14.9911  2.71043  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -216.89  14.9911  2.71043  0.31955
protocols.relax.FastRelax: {0} CMD: min  -229.092  15.0821  2.68883  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -229.092  15.0821  2.68883  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -177.443  15.0821  2.68883  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2605 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -177.919  15.0821  2.68883  0.55
protocols.relax.FastRelax: {0} CMD: min  -204.6  15.1665  2.5453  0.55
protocols.relax.FastRelax: {0} MRP: 3  -204.6  -204.6  15.1665  2.5453
protocols.relax.FastRelax: {0} CMD: accept_to_best  -204.6  15.1665  2.5453  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -204.6  15.1665  2.5453  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -204.6  15.1665  2.5453  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -277.497  15.1665  2.5453  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2969 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -285.147  15.1665  2.5453  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -283.132  15.1665  2.5453  0.02805
protocols.relax.FastRelax: {0} CMD: min  -327.332  14.9731  2.72277  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -327.332  14.9731  2.72277  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -185.51  14.9731  2.72277  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3330 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -223.273  14.9731  2.72277  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -216.126  14.9731  2.72277  0.154
protocols.relax.FastRelax: {0} CMD: min  -275.376  15.1032  2.68756  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -275.376  15.1032  2.68756  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -229.983  15.1032  2.68756  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3060 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -230.378  15.1032  2.68756  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -226.797  15.1032  2.68756  0.31955
protocols.relax.FastRelax: {0} CMD: min  -236.64  15.1707  2.70773  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -236.64  15.1707  2.70773  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -188.728  15.1707  2.70773  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2832 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -189.086  15.1707  2.70773  0.55
protocols.relax.FastRelax: {0} CMD: min  -206.656  15.1702  2.54476  0.55
protocols.relax.FastRelax: {0} MRP: 4  -206.656  -206.656  15.1702  2.54476
protocols.relax.FastRelax: {0} CMD: accept_to_best  -206.656  15.1702  2.54476  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -206.656  15.1702  2.54476  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
Working on decoy: outputs/1BL0/decoy_0.pdb
protocols.relax.FastRelax: {0} CMD: repeat  70996.4  15.8152  0  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  70996.4  15.8152  0  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  7196.67  15.8152  0  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2691 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  63.5881  15.8152  0  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  87.8007  15.8152  0  0.02805
protocols.relax.FastRelax: {0} CMD: min  -308.593  15.8619  4.6998  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -308.593  15.8619  4.6998  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -156.516  15.8619  4.6998  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2704 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -191.313  15.8619  4.6998  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -183.497  15.8619  4.6998  0.154
protocols.relax.FastRelax: {0} CMD: min  -268.035  16.0431  5.31282  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -268.035  16.0431  5.31282  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -222.994  16.0431  5.31282  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2511 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -223.602  16.0431  5.31282  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -220.149  16.0431  5.31282  0.31955
protocols.relax.FastRelax: {0} CMD: min  -234.474  15.9838  5.63319  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -234.474  15.9838  5.63319  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -193.736  15.9838  5.63319  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2451 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -194.23  15.9838  5.63319  0.55
protocols.relax.FastRelax: {0} CMD: min  512.29  15.737  5.5649  0.55
protocols.relax.FastRelax: {0} MRP: 0  512.29  512.29  15.737  5.5649
protocols.relax.FastRelax: {0} CMD: accept_to_best  512.29  15.737  5.5649  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  512.29  15.737  5.5649  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  512.29  15.737  5.5649  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -266.693  15.737  5.5649  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2583 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -284.39  15.737  5.5649  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -277.657  15.737  5.5649  0.02805
protocols.relax.FastRelax: {0} CMD: min  -359.462  15.9707  5.30416  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -359.462  15.9707  5.30416  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -218.787  15.9707  5.30416  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2971 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -244.745  15.9707  5.30416  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -237.824  15.9707  5.30416  0.154
protocols.relax.FastRelax: {0} CMD: min  -300.453  16.1169  5.42811  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -300.453  16.1169  5.42811  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -258.294  16.1169  5.42811  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2685 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -258.96  16.1169  5.42811  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -255.713  16.1169  5.42811  0.31955
protocols.relax.FastRelax: {0} CMD: min  -268.541  16.181  5.60837  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -268.541  16.181  5.60837  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -228.414  16.181  5.60837  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2596 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -228.641  16.181  5.60837  0.55
protocols.relax.FastRelax: {0} CMD: min  -255.13  16.37  5.68145  0.55
protocols.relax.FastRelax: {0} MRP: 1  -255.13  -255.13  16.37  5.68145
protocols.relax.FastRelax: {0} CMD: accept_to_best  -255.13  16.37  5.68145  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -255.13  16.37  5.68145  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -255.13  16.37  5.68145  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -313.105  16.37  5.68145  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2914 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -325.18  16.37  5.68145  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -322.525  16.37  5.68145  0.02805
protocols.relax.FastRelax: {0} CMD: min  -372.767  16.4538  5.82027  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -372.767  16.4538  5.82027  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -244.541  16.4538  5.82027  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2876 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -273.481  16.4538  5.82027  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -267.388  16.4538  5.82027  0.154
protocols.relax.FastRelax: {0} CMD: min  -312.92  16.3746  5.82074  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -312.92  16.3746  5.82074  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -270.658  16.3746  5.82074  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2742 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -269.784  16.3746  5.82074  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -266.516  16.3746  5.82074  0.31955
protocols.relax.FastRelax: {0} CMD: min  -280.459  16.3339  5.87434  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -280.459  16.3339  5.87434  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -241.716  16.3339  5.87434  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2621 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -240.83  16.3339  5.87434  0.55
protocols.relax.FastRelax: {0} CMD: min  -255.611  16.3016  5.85431  0.55
protocols.relax.FastRelax: {0} MRP: 2  -255.611  -255.611  16.3016  5.85431
protocols.relax.FastRelax: {0} CMD: accept_to_best  -255.611  16.3016  5.85431  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -255.611  16.3016  5.85431  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -255.611  16.3016  5.85431  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -314.724  16.3016  5.85431  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2884 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -326.377  16.3016  5.85431  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -324.026  16.3016  5.85431  0.02805
protocols.relax.FastRelax: {0} CMD: min  -364.981  16.3579  5.97787  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -364.981  16.3579  5.97787  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -245.093  16.3579  5.97787  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2875 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -283.709  16.3579  5.97787  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -278.563  16.3579  5.97787  0.154
protocols.relax.FastRelax: {0} CMD: min  -312.831  16.3238  5.94176  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -312.831  16.3238  5.94176  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -271.702  16.3238  5.94176  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2617 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -272.508  16.3238  5.94176  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -269.3  16.3238  5.94176  0.31955
protocols.relax.FastRelax: {0} CMD: min  -281.519  16.3364  5.8906  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -281.519  16.3364  5.8906  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -242.994  16.3364  5.8906  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2556 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -243.652  16.3364  5.8906  0.55
protocols.relax.FastRelax: {0} CMD: min  -257.82  16.3381  5.83681  0.55
protocols.relax.FastRelax: {0} MRP: 3  -257.82  -257.82  16.3381  5.83681
protocols.relax.FastRelax: {0} CMD: accept_to_best  -257.82  16.3381  5.83681  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -257.82  16.3381  5.83681  0.55
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -257.82  16.3381  5.83681  0.55
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -316.53  16.3381  5.83681  0.022
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2937 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -324.164  16.3381  5.83681  0.022
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -321.512  16.3381  5.83681  0.02805
protocols.relax.FastRelax: {0} CMD: min  -380.562  16.3869  5.89136  0.02805
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -380.562  16.3869  5.89136  0.02805
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -236.721  16.3869  5.89136  0.14575
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 3139 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -262.968  16.3869  5.89136  0.14575
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -255.498  16.3869  5.89136  0.154
protocols.relax.FastRelax: {0} CMD: min  -314.522  16.3848  5.85171  0.154
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -314.522  16.3848  5.85171  0.154
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -269.971  16.3848  5.85171  0.30745
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2638 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -271.265  16.3848  5.85171  0.30745
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -267.866  16.3848  5.85171  0.31955
protocols.relax.FastRelax: {0} CMD: min  -283.872  16.4205  5.6656  0.31955
protocols.relax.FastRelax: {0} CMD: coord_cst_weight  -283.872  16.4205  5.6656  0.31955
protocols.relax.FastRelax: {0} CMD: scale:fa_rep  -245.949  16.4205  5.6656  0.55
core.pack.task: {0} Packer task: initialize from command line()
core.pack.pack_rotamers: {0} built 2585 rotamers at 116 positions.
core.pack.pack_rotamers: {0} Requesting all available threads for interaction graph computation.
core.pack.interaction_graph.interaction_graph_factory: {0} Instantiating DensePDInteractionGraph
core.pack.rotamer_set.RotamerSets: {0} Completed interaction graph pre-calculation in 8 available threads (8 had been requested).
protocols.relax.FastRelax: {0} CMD: repack  -246.12  16.4205  5.6656  0.55
protocols.relax.FastRelax: {0} CMD: min  -259.542  16.3728  5.80664  0.55
protocols.relax.FastRelax: {0} MRP: 4  -259.542  -259.542  16.3728  5.80664
protocols.relax.FastRelax: {0} CMD: accept_to_best  -259.542  16.3728  5.80664  0.55
protocols.relax.FastRelax: {0} CMD: endrepeat  -259.542  16.3728  5.80664  0.55
protocols::checkpoint: {0} Deleting checkpoints of FastRelax
decoy_poses = [prs.pose_from_pdb(f) for f in glob.glob(job_output + '*.pdb')]
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_41.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_1.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_37.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_13.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_5.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_33.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_39.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_9.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_47.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_11.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_32.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_26.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_4.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_49.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_40.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_10.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_43.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_35.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_21.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_14.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_7.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_6.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_2.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_24.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_8.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_42.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_20.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_17.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_25.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_22.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_44.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_34.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_45.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_3.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_23.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_38.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_16.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_18.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_28.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_48.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_15.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_46.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_30.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_19.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_27.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_0.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_36.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_29.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_31.pdb' automatically determined to be of type PDB
core.import_pose.import_pose: {0} File 'outputs/1BL0/decoy_12.pdb' automatically determined to be of type PDB
def align_and_get_rmsds(native_pose, decoy_poses):
    prs.rosetta.core.pose.full_model_info.make_sure_full_model_info_is_setup(native_pose)
    rmsds = []
    for p in decoy_poses:
        prs.rosetta.core.pose.full_model_info.make_sure_full_model_info_is_setup(p)
        rmsds += [prs.rosetta.protocols.stepwise.modeler.align.superimpose_with_stepwise_aligner(native_pose, p)]
    return rmsds
rmsds = align_and_get_rmsds(native_pose, decoy_poses)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 16.0749486)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 13.7203129)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 13.2966451)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 13.0070544)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 15.8656847)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 15.0177827)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 8.6426712)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 14.2624658)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 15.7576579)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 15.2344505)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 11.8111064)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 14.3916371)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 11.5669502)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 14.2517303)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 10.6665747)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 11.3997096)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 13.4343577)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 14.6675384)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 12.6858497)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 14.3173897)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 15.6631114)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 12.4177234)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 12.2831697)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 13.3869583)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 12.4568750)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 12.9834670)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 16.3765487)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 13.1323020)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 13.0464896)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 13.8716525)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 18.5292170)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 10.8900181)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 16.3824096)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 14.7845234)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 14.3066570)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 14.7304969)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 14.6828258)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 13.5188697)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 14.5680718)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 13.7590911)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 14.9518502)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 13.5388681)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 14.6357603)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 14.3190860)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 12.8806290)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 11.6794996)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 13.2683752)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 14.1678686)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 14.1342224)
protocols.stepwise.modeler.align.StepWisePoseAligner: {0} RMSD 0.000 (0 atoms in ), superimposed on 349 atoms in 1-116 (RMSD 13.0230631)
rmsd_data = []
for i in range(1, len(decoy_poses)):  # print out the job scores
    rmsd_data.append({'structure': decoy_poses[i].pdb_info().name(), 
                      'rmsd': rmsds[i],
                      'energy_score': scores[i]})
rmsd_df = pd.DataFrame(rmsd_data)
rmsd_df.sort_values('rmsd')
| energy_score | rmsd | structure | |
|---|---|---|---|
| 5 | -212.465333 | 8.642671 | outputs/1BL0/decoy_39.pdb | 
| 13 | -240.561878 | 10.666575 | outputs/1BL0/decoy_40.pdb | 
| 30 | -197.577797 | 10.890018 | outputs/1BL0/decoy_34.pdb | 
| 14 | -228.841333 | 11.399710 | outputs/1BL0/decoy_10.pdb | 
| 11 | -246.439027 | 11.566950 | outputs/1BL0/decoy_4.pdb | 
| 44 | -202.633616 | 11.679500 | outputs/1BL0/decoy_0.pdb | 
| 9 | -210.981925 | 11.811106 | outputs/1BL0/decoy_32.pdb | 
| 21 | -226.524213 | 12.283170 | outputs/1BL0/decoy_2.pdb | 
| 20 | -247.146657 | 12.417723 | outputs/1BL0/decoy_6.pdb | 
| 23 | -245.230839 | 12.456875 | outputs/1BL0/decoy_8.pdb | 
| 17 | -230.346306 | 12.685850 | outputs/1BL0/decoy_21.pdb | 
| 43 | -221.430421 | 12.880629 | outputs/1BL0/decoy_27.pdb | 
| 24 | -217.765265 | 12.983467 | outputs/1BL0/decoy_42.pdb | 
| 2 | -171.492482 | 13.007054 | outputs/1BL0/decoy_13.pdb | 
| 48 | -206.656022 | 13.023063 | outputs/1BL0/decoy_12.pdb | 
| 27 | -231.875544 | 13.046490 | outputs/1BL0/decoy_25.pdb | 
| 26 | -246.405521 | 13.132302 | outputs/1BL0/decoy_17.pdb | 
| 45 | -247.928967 | 13.268375 | outputs/1BL0/decoy_36.pdb | 
| 1 | -204.065171 | 13.296645 | outputs/1BL0/decoy_37.pdb | 
| 22 | -232.097261 | 13.386958 | outputs/1BL0/decoy_24.pdb | 
| 15 | -204.623999 | 13.434358 | outputs/1BL0/decoy_43.pdb | 
| 36 | -217.331318 | 13.518870 | outputs/1BL0/decoy_18.pdb | 
| 40 | -192.461436 | 13.538868 | outputs/1BL0/decoy_46.pdb | 
| 0 | -237.576119 | 13.720313 | outputs/1BL0/decoy_1.pdb | 
| 38 | -201.588690 | 13.759091 | outputs/1BL0/decoy_48.pdb | 
| 28 | -201.080937 | 13.871652 | outputs/1BL0/decoy_22.pdb | 
| 47 | -246.443942 | 14.134222 | outputs/1BL0/decoy_31.pdb | 
| 46 | -198.982626 | 14.167869 | outputs/1BL0/decoy_29.pdb | 
| 12 | -258.721131 | 14.251730 | outputs/1BL0/decoy_49.pdb | 
| 6 | -196.454980 | 14.262466 | outputs/1BL0/decoy_9.pdb | 
| 33 | -207.462713 | 14.306657 | outputs/1BL0/decoy_23.pdb | 
| 18 | -207.670695 | 14.317390 | outputs/1BL0/decoy_14.pdb | 
| 42 | -212.505728 | 14.319086 | outputs/1BL0/decoy_19.pdb | 
| 10 | -226.916452 | 14.391637 | outputs/1BL0/decoy_26.pdb | 
| 37 | -268.483687 | 14.568072 | outputs/1BL0/decoy_28.pdb | 
| 41 | -203.800862 | 14.635760 | outputs/1BL0/decoy_30.pdb | 
| 16 | -240.814460 | 14.667538 | outputs/1BL0/decoy_35.pdb | 
| 35 | -212.352972 | 14.682826 | outputs/1BL0/decoy_16.pdb | 
| 34 | -243.125585 | 14.730497 | outputs/1BL0/decoy_38.pdb | 
| 32 | -232.733875 | 14.784523 | outputs/1BL0/decoy_3.pdb | 
| 39 | -225.605436 | 14.951850 | outputs/1BL0/decoy_15.pdb | 
| 4 | -220.540794 | 15.017783 | outputs/1BL0/decoy_33.pdb | 
| 8 | -233.236372 | 15.234450 | outputs/1BL0/decoy_11.pdb | 
| 19 | -231.258347 | 15.663111 | outputs/1BL0/decoy_7.pdb | 
| 7 | -255.882500 | 15.757658 | outputs/1BL0/decoy_47.pdb | 
| 3 | -199.233768 | 15.865685 | outputs/1BL0/decoy_5.pdb | 
| 25 | -212.330077 | 16.376549 | outputs/1BL0/decoy_20.pdb | 
| 31 | -224.865241 | 16.382410 | outputs/1BL0/decoy_45.pdb | 
| 29 | -198.842741 | 18.529217 | outputs/1BL0/decoy_44.pdb | 
import matplotlib.pyplot as plt
plt.scatter(rmsd_df["energy_score"], rmsd_df["rmsd"])
plt.xlabel("energy_score")
plt.ylabel("rmsd")
plt.show()